MZ@ !L!This program cannot be run in DOS mode. $PEL5 #    8` p̧  .text   `.rdataD  @@.data@ @.idata6 t @.rsrc  @.reloçpJ@B t t̐ t V~ ff h F^ÍFPfY3AA AAAAVWN83j^F F eFF F$ F0F4L_ Ou_^Vt$u^PjJPĐ &UQQSW}مG!Vu639sC PcY{3^_[C PFY;s|у{ s t_;{tыPEY҉UtK;|N6sM+3<ʃs V6E}YwP@ YdM6ȃu;s}C tKFVt$t&^ËAvHAÅtj3(/ 6 (/ h' V ^D  U VW}u9%SuFPQ!~Y~ 3[_^~^tc;~ tPEY҉Ut΋N ;$3Ep M+3<ʃSEu}Y눋PYuVD$tVY^|$tt$j5` Đ @/ + @/ @ VFH P~Y^ËD$V|;A }Qt$ ЉI^D$ 3j@ËQ#D$+#;A #(/ ,5 (/ ' SVW0" 3j[8Ku/_^[ùh' ' VWjq_=ưOu_^SVWx" !j[ " KuN8_^[# j / 5V / H* V# ^UQeSVuW";r "B E J +It ztJ rd8tJE_^[VWw ug ggg_3^SFPYVYu[ι0' VX! ^ËA ËD$V ~!PD$ PP^Vt$NFt^tVOY3L$HL$H  VWP3PPN~WWWNf~ _^ËL$`HL$' HL$ H V3PPPNFFF F@@0 ^^Ë2ɈHHHH' Ë @ËVL$ڍq#֊PPQPQPIH' ^|$tt$jt$ ̐ t$jPV h ff F^ËT$VҋeW3I_QR^UQSVW39} ى}~Du;t=Wu =;ljEu#9{ ~M {ȃK$CE_^[UQQESV3;Wىut9;C |4@PEVY;}<9u u!DEsC {$>E_^[C;t؋Kȃs}t$jP ù0' V3X! F FF^V%f' ^Ë`" Ë3ɉHHH HùH* Vf fF# ^UVW3Ct9H 5\ tuuu Pօuuuu 5 օuX_^]V395@ u95 n^#5@ SVjt$k؅u.Wt$t$v`~؃3 IN_^[QQSd$UVWCH;K }>uE!D$-h L$u:vD$C 3kIKD$_^][YYQL$@Y붋sȃ뱋L$HH8( U=D VuE3^]UQVFt=D E33ɅANvY^SVt$ 3W;w|FP?؅u#G u|$tGt$P-YY_^[|$QOt$j1P VW|$tGt$ u>_^` t$jP ËAVWt$t$P_^9A]S\$VW|$#jW*u L$׋~ ɉ tAFN ʉ _^[ UQQeSVW}bM ~!F;\F;|WEE_^[U3S9E t>E jCPu,M W{{VuʃʋSKK^_  []Uu39Euu uP5L $ HH]Vff F# ^Ë`@( S\$VW|$#jW'uT$ϋ~҉tFVщ_^[ UQQeSVW}M ~!F ;F;|W;EE_^[VN=N5( ^Vt$FtHF^FW~FPftj3_ԁl$D$H@PAPQËD$@@VfNh@ H ^VW|$ G NF GFGFGPwVY3Y_^VL$ڍq#֊PPQPQPIH^U0SV3W;f]]f]]ty3}ЫSMSQMQjSh( uRP;~u ESPEPp ;ZE }u( ȍEP jX_^[ Il;t Vh( Q;k`` Ë( XXVW|$ ٍG#Ȋ NFGPNGNPfG_fF^L$HL$H( V N ffF) ^Vf X) ^V3) F FFF^USVu u3=WMuE9M9M ;uP39K~C PGY;{|{ { u$'cEuMsKM K_^[WVY9K { u*PY҉2M3ʃ뤋K;~P|Y҉UK73sM+<ʍs VEYu:V)  ^ËjjËQ3PPPRËD$ Vu FNPD$SVWsH{>D$( ڍH#ъV N@FD$ٍp#Ί OO@G_^[AYXA Yv AA AY U E VWQG`w$`QM$EM#يEEɉGE#Ί HHO_H( ^U E VW@GQw$@QM$EM#يEEɉGE#Ί HHO_H( ^U SVWs{EM2 PNЍH#ъV N@FEMP$ȍp#Ί OO@G_^[VW|$ GFGF _^UIuEu PUP UP@UEEPQ, ыT$V3рu^фt$RQVt$W>VY@VP_^W|$ 3|$jIQt$IQt$_UQQSVuW3SD`\L]w^$p5` hY;YF!(@ )5` hY;YsF],8? uuWTMQP`;uMQPh5` hdY;YF(> 5` h9Y;YE+8= a5` h Y;YE.(< 35` hY;Y}Eg+8; 5` hY;YOE(: 5` hY;Y!E +89 5` hSY;YDv(8 {5` h%Y;YDEU5` hY;YD5` hY;Y{D벍EPYB_^[VW]N N(B N0~N@|NT~,qNdiNt~P:@B _^UQE HVUD@Ht0RQuEPY^UQSVW} W]Eu@WPHE t'Etu tPYE YPYE_^[ ЋˉUM;t P*$P),P)SVt$V$8(^8USVu3W V4$4(4,4PL PEEPYVPP$PEEPYVPT(PEEPYVPX,PEEPb Y_8$8(8,8 $(,^3[]UQV5` j,YYQjjBt55` j8YYQkEuEPY^V+D$ L$F3FFF F$F(N0C ^Vff C ^VN,N0^jD ^X^F F$^(^SVW|$tP\PS\t WVYY_^[jXÃVW|$ tVWVYY_^USVWM }u5} uCW[Nt7GH7_^[]Px؋Px;ujWP|E E PZQD$SVL$W΋Pt3~&UWtL$PxPG;|]_^[YUVW5` jYYO3t%E$7PΉE}EP~Y_^]Vff(E ^Vt$F@HK5` HKj83YYK^UVW5` j YYOt%E(PΉEEPY_^]3V5` jYYg>XE ^USVWX }X tPT9D4u_^[]  Gt4EuSaYEYP=YNjD$V $p5` jYYQj# 5` jYYiQj~#^5` jxYYEQz 5` hYY"Q5` hxYYP5` hUYYPIp5` h/YYPJ$P taHt85` jYYzPNF HF 5` hYYAP5` hYYPkt%HO5` jeYYOj~5` jGYYOj>Vt$W>UVP@VP"_^Q @D$+/;A&VD$tV Y^VFP4 P赿Y^ÃD$D$F F ËD$ Vu FNPn_^ú1 ( QPADA(( A8A,0 QVW~* >谳 蚳~@~Fl0 FP " _^VW=̓ F4tP׃f4F8tP׃f8FP\ËD$ Vu FNPVuP;>tM } uك>tރ}tMj \ p_^[D$uPL$|~~D$ދD$ ՋD$uPL$|~~D$ދD$ҋPL$jXjXjXjXj Xj XUEjZ(;}GuPM ]|E j Y"t;|݃~1 ӋE ȋE t~E 맋E UE'}C}PM ]E j Z$t|;~j Z;ȋE ˋE t~E jXjXj XV8A ^Vt$ G ^V3HH 9D$f@F ^3UEQfEVuj VPR^] Vt$ zYYt%t$PTN<Ƀ QP`^  ȍ +ȍÞ& %ËD$;ADt y@ADVD$PNFjjjN胡ff ^VW|$ F;`u tPj5` Đ &~3_^9Pj5`  =UE VW; hZ tMuPR _^] jhZ Y3uۋEM@3UQE USV ;`' WM;xZ  ;Z ;Z &;Z 9;Z Ou MR_^[Ul$ Vt$ Wы='vs=V H=B:=#D==Z Z 3ݐJD9]t9]tF,G9]tF,uF,F,tU(SVEW3ۋP]] 9_wtC3}ثSUSRUثRjSh( h;PQE;uXE;u\38]_^[ËGURh[ P;|͋EURPQ;|E;tVh( P;|y]PQ띉]PQ뙃l$Ql$$Œl$$=AL$+A@vYvvD|wD$ @U胗ME@EȋEEċE@E̋E@ EЍEPEMPEPjhCM蹒oEPju ou u E}t}ouEPuh juܓ $E؋EEE@EE@EE@ E+PM}xoE$Puu蚞EtZ}.pEHPjjEP^D$Vڍq#֊PPIH ^UdS] Vee W}EEu% E "t{;ddEhhESWWMPԭ-Eԍ,PWdVWPdVWPdVWPd(VWPdu uEEωdEhu9E u ؑ EEE_^[ 3VWVTVFV 8(V * 39` 39\ t_^à Vuj^t t$PP^dUQSVW} 3S8$S,(S ,SL;XPpEMQP`;tuT +MQPh_^[IAPVq tPtL$F^D$!03v4V39`t^9Lt9tPPP!PDL`U4SVWM訅MPEeeM̋؉EEEEEP$tyt DcE苆9E6]ΉES輣3PEER EkeEM̉EEP=끍M_E_^[UQSVuW3ۋMQP`}tuMQPRDM؋QPh_^[UE SVW3{ 0uu97uutO7~ tqMPEPSu7CM E_^[5` j`J{Y;YD7;Ɖ:7뇃}u}tuuu{~ tEMSPEPuzRMQWPtjVz{>ESPEPuuzV3j phI H ZqJuppXp\^ÃUSVW~ 5}E Pu WEU5N;M ~΋IX;M E G|E FD3_^[] UQQeSVW{O EE+E|1+‹M utFuE5~ŋE;ljE#tM 6u~E9}~EM3_^[ K5L$t$PVW|$ ϋP-uM؉EuuS)-uM EuuS-uM EuuS,M ȃ}tRF,PEPFPWR`uu VS_H$)uVSBHu(VS2Hu싏,VS"H tytVPSRX$tytVPSRX(tytVPSRX,u>MtjMtjMtjMtjE[_^ytVWSPXUM%EM+EM j)M]ـ؁XËـÃ|$sHsD$5` jp$^YYet$t$t$t$ Vt$t$t$t$ J ^L$HL$HL$ H L$HK UEVQ$Y,pjZEYFdpjZYVh#3<FhEHK jY#ELK #flEt%Hu9M uP HuP^]P PVW'F ~j H Z~0NVLN4F8VT_^UQA SVWqxy$y aH_jY(_uqy0Pp_ fI^jA8QQ yLyTXQv؅ۉ]tXj=M C@E胹{je}E EPE=xEE;F_3_^[;M9M;@;H 9MEF(E ؋]EE;EE4FuEuMPvRhEvMuuvPl}Et}uEM yhuuuPPEċPWЍHһ #ъU M@EEF] ؋F E  ؋EMЙ}PE}P5OEԉ]EԉEE؉EF$ At@$jX9AhuÃyHAhjX9AlËD$;AHuAH39ADApQPPPRދD$ Vu FNPEPu P)E qe p/ C0[0C<[<U4SVWMJeu] 1 C CCQ$Q$QM$JMPEPЍH#у}UUHM@ E}܉}VVEV kVEVV E}EjYCEjYC EjYCU]ҍF#Ӌ] HUPUP #ъV NHN @ Fe^#^^0^E^ =_^[ VW|$ ڍGNP#ЊKNWK(B _^SUl$ VWUE$K(C$E(PEDٍp#Ί KHKH@CLEPPKPCD( yKE`jC`Xud{d󥍵󥍵󥍵$$󥍵dd󥍵󥍵ȋ_^0 ][VW|$ ٍG#Ȋ NFGFG F GPNJG 0 F _^USVuWQFf $FfQM$WB} QGg $GgQM$8BQ$F Q$FQM$GPxGԇPQ$EuQ$EuQM$kGP8G:PQ$G Q$GQM$4GPr_^[SUVWjYCdPjYUȇ_^][U0SVWuXt{hQ$Q$QM$GPQ$Q$QM$GPQ$Q$QM$GP QF$Q$QM$GPQ$Q$QM$iGPQ$Q$QM$NGP FQ$Q$QM$&GPQ$Q$QM$ GPQ$Q$QM$FP QF $Q$QM$FPQ$Q$QM$FPQ$Q$QM$FP F$Q$Q$QM$jFPQ$Q$QM$OFPQ$Q$QM$4FP QF($Q$QM$ FPQ$Q$QM$EPQ$Q$QM$EP F,3_^[USVWuETPdPMu TEdPPMuTEdPiPMEeQ$EeQ$EeQM$CEMPEeQ$EeQ$EeQM$CEMPLPsFWϋiFPSQ$Q$QM$DDP>FP_^[ D$V@ Q$@Q$@Q$:C`1 ^UE VMQAHAH$A H@ IQ$@ IA HQM$(DЍH#ъV NHN@ F ^UQSVeW`|`PtvW}}Lu`}XAOA OA$O xK w3؋`E`Pt9Er%f;_^[A,FUS]VW} MCGQ$C G Q$CGQM$AuEM#QFEFEF EFG c $GcQ$GcQM$AEM#FEFEFEF F%K ^r&F%K ^ rMV_^[W3MF^F ^ F^F^UV3W9EٞtB9tB}ϋG ٞ(PuٞWu Vu_^],ٞQ$I v!"U8S39]Vu WM]H9,<9^83EQE] نu $$39E$E]썎SEpBU;tOL;t ;FH;uJ;t @E@(Eؾ DȃEH@PtE] 9X]u PUME Q Q]Q$]E]3URURWPVuf~hEEM%K ]8}E E؋EE܍EԍMPa_EȋP%E E( E EM ;H(EQ$S EE_^[9OjX=@M3f9 EEPV113Q$u?EUQE$t @MEMX(D$;AhuyHAhUSVuW΋] x3΃E@K tuPjY39W9Uu9Uu>uRqjX3EtpuEEPU_^[]t3몋Мj_;t;ݜ;՜NjuPpEP}U3닋EMu~@EEsTU SV3W}9^HtbF|O@GQMP.-MUɍ#ʊ ME9^D^H^p fFNSSSP_^[F|O@GQMP,;Et jX;lŋ;Eu3USVW}GP;GLui(EtʘE 39,t9F8u 9F<NEE Q$P,_^[]뙃ËI03D$v D$USVW~m} jP؅S@HvvSWu^vK؋EE  ~7OSPPuϋuuVuE ن0>;i_^3[]D$VWj~ FPFWPFPr_^UVuW} 3|EoS]]E -&u K Uh=K EK E,E3ɺ r A | U =J EREHME 9E]%J U<J EEm sMMErL}teEur8EjX9E ʚe3 @-iF~,~jWG/D GvH]_^[jWG G0VWt$tT$ +QRR _^UWVu }M;v,;s$u_у$UY у$UE^_fFfGFGE^_ÊFGE^_NO P E^_ËT$:tD 8tB:uB8t8:tL$ 3A D$ 3ËT$3;V0r;q 0qQ^S39\$ Vt$ Wu8jXFT9FT|FPFP;G fTޅtVPLVPH_^[FP;G }G$뾃 SVWh |$ tB}߾ |$$\$t5t*Tt@f:sRS1u_^[ fčL$ BARQL$ȃSVt$(WfN U3T$4fR |$f‰|$f3|$f%fffD$fD$f(f(f=(f=?'f'3f'3D$$D$ |$ +D$ D$(~=D$$l3ɋT$4f 3f7UQUR 'L$(u˃D$$D$ |$ |fl$?f|$'|$tQf|$'f9D$wUf|$'fD$L$fT$fD$Nf D$VfF ]_^[ÍD$PufL$f|$듃|$tD$3ɉL$|$y'L$f|$^'fD$fD$mV3T$ L$4;w ;wL$1^øT$VWJM _BB ^BVWt$ NFыN ‰F _^VWt$ |$VPQQ u.FOPQR: u1NVGPQ" _^ÍFPjQ tFFʋI,3D$wD$I(3D$ULSVW39};t T]QC ٞ(CC$CQ$QM$$MUɍ0#ʊ ME4E8<QPRQ|QPQQP uˉ 9,ٞ t9~8u 9~<uSu Vu_^[ GP^PGX^XG`F`GdFdGhFhGlFlGpFp$$GtFtGxFxG|F|PEuKEPYXUAHju u5AjqTAQ$AQ$QM$]#MPqTPAQA$AQ$QM$UAHju u5ADjqLA@Q$AD$;;A`uyHA`D$';";Ad UVu W1E E Qؾ$)uuVu_^]UVW} <35` jYY6|E~ F L ^ut@URVPDEP Y_^] UVW}ϋP8-@ @EuBP8- @E6P8-X @EPWPX_^]F H@ øX SUVW|$N W Y4j4+@39<99<9  ;ttu_^][;͕VD$tV Y^J K SV3W9 tU\ j@Y W PW  dž pC.SSS ;9X X t'RP ҃RVt$ t$ t$ Pt_^[ Vt$FPYFYt$PD$YYF ^ V` t &Md t Mh t Ll t L^US]VWLuMET 褚]Ћ]ˋPpuu EVuS3ME싆xEMME(B uV,E] ف$ن@%L PQ]E e$EE EPQ,$E EPQ,$EPS]M Q$EE]Pj#Q$oPh=]ԋXe}]} uMQMQMQSuuuE]E]EwEMQP Q$PXE]Ի1 XE]EwEȍMQMPQM$Ph}hyu G] E EPQ $?E GEPQ $&G |L EPQ E $uEP uuEuPuPEuPEPuQ$EQ$uuuEt3M]ЋSQxQuPDEPYEE;E}]_^[UQVWM uEH E ف$UE ن8Eن<_ uEE L ۀن8%L ن< L OW  $Ԝ_^V貍^ËuPxËD$D$,UVtBuV$EM؆(L [L Y^]EU싁u EE X]EE uXX U  Eu TU VuENdPg~t F$E^Ef\Q$EfXQ$EfTQM$EMEMEM뻋Izt$PlD$I(HwIAwQRPpËwIwQRPpUVwن$L vuV$EM؆(L vL v^]Izt$PhUIEu#A( L ]u PlE]tU@uMMVM} #} <EEȋE |L E]EMPIEPET `AY0A Y0AY 0ËD$V@Q$@Q$IJ fF ^QPVW3uыBLt$ tRDF\TtV _^FZuF tJ USVqPWuFH39FLtyulNLFDANLMڍy#׊PPQPfQ fP ~LtJ^\rU^hvFhA^`rBA^lw?_^[ P$uQQM3PNTTЋF\볋AF`AFl3 UVW5` jtiYYMjju Ew uQ$EQ$uu uf<L _^]$UEVWQ$EQ$uu uLu~@E M,FdE$FlNp@M $@}(FhgN<_^](USVW\Ef f~ ^NFM EuN,f0f<F4EWF80N y YYu Sn YY_^[]UMSVW3N}~0 tF9k}͐E_^[UVuWP8-X @Eu>P8-@ @EuQP8- @EVPX_^]v ttヾ<u򃾔ujX̸ USVW}G8f8N tN ؃_^[]~4|4|GfN uƋPp؋Pp+؉]EN uGN؋+EEN x+؉uEiN jXfQAhUQeSVW}كrp9sHt_KPYEKKLsH;~KɉKLtsD}ȃsD9YKEE_^[j^US]VWPpuE\ EE$3E;EMQMQuPS贚@tQ:N a]N OUsEN vE]EQQ$EQQ$uSuu EE`_^3[UPSVW}3ۋW]E_^[ Vt$%~3~^USVW~5` j`YY] ;t~FXEF+jY;|ȋEtx\FXw\GXF+~X~DWM Mu] )NGOW@w V3_^[]5` hYYټj+ͼp4NH`M>jYJD$Wj bBz Y3N j z4Yj z`Y_SVWF \$H3~ V49`;iG;|L +@QQ(Q,QTQXHuD$L$DL4P D`FP D\3_^[ AUQeSVW_KÃ}Mu;D EUM2u}U\3M ;wD8MD4_^[+‹Mut uދ+E끃EF;뉋D0렋Q|A`BH;L$t JuL$P3S\$VW|$3utSj X+St$+‹VPf%_^[ UQSVWM ujAZ@U;~ 891E~VN\I|Q\U ֋!MuFO+ȅ~LVE!Mu)GE MvDPREWYY_M T\V^T`[ L$jUlSVW}P0u M̋؋QPDMME̍~PSE2 ESPPMz>EM+EPE+EPEMMPEMPfEMPEP;{PM1>E̍~8PSukESPPM >EM+EPE+EPEMMPEMPEMPEPzPM=E̍NTPS_^[UVWPsEURPTURP4H;O@;GjXt_^VTx`tt jX^3^Ët ]33^AAU4VW} OQMQP@PMWQP@PMyzMPE_^USVWYURPTURP4H;O@;GjXtoMEPE Q$@Q$@QM$l PeEQQ$YY EPQQ$YY MPE_^[M Eڍq#֊PPIH UTx`tVuEP.@Q$@QM$<EEMUɍU#ʉEE E(  HMXH$뢋H;H!#H ;HËP HPH Vt$֋ڍNW#эyP#׊PPIH Nѿ ڍqx#֊PPIxH_2 ^UlSVW}W_f%$^[UPSVWMME2 VMEP2E_^[UXSVW~~TNWVFQ$FQ$F QM$FQـ($FQ$F QM$Nف(K uNFW&ME؈ FFـ(F EFEEPEP6];_^ tEWPEP6딃4UUSVWBK TMRuu _^[UVW}tCM MEPu+EPu UWRUR_^ UuTEPߤ@Q$@QM$EEMUɍU#ʉEE E(  HMXHUSVW~ts}tjW؅uEPSu EPEjuuv uuv 5P O2Puuv =_^[ D$8Au8auA:D$ ujX3VQ tVY^ËT$VWTjpdY󥋺TjpDY󥋺TjY_^Vt$WFP~luV_^UW} rujVMM$E( n (E&](ΉE&MU]R^_3HvUVFtuuP\~,tu uu ju^]VW3N~~N ~ ~~Z~\(O _^ËD$Ph `HL$ Vt$_3_^UQVWMGwQP`mGtu uP`_^UQSVWMGwQP`] .mGtu;_1E _^[Vt$QQF$(^FYYQQ$^YY^SVW|$G5F \$G$F_^C[`TVt$WV~TuF0uVPP_^U MV391Q9WHق}E9qTEE]f9"}E]ق(K E;EAuQ AUPPEUQE( P21IP_^UDSVuك>tYWMFـ%K ]ќCECeENuIuE}|_^[uVE EȋP觌ЍHu#ъU M@ωEE 豆j6PPEPCYM.MPCPMPFE MMU K Ff"}wEEFMFPEԋPjNuE W6FMEP荥}eEUQQ3V9E WuN5` jYYE@ ]HEfN G ^ƅtOtI,fH_^USVEWP]H@KC{QPM-;Et{EPъH@KQPMMUɍ#ʊ MEˉɍ#ϊ CV3NPPPFpR_^[;EvF|;e@;CYUTSVu WM~xMWEjEEΉEE uuPPF8j[HӋF<H4jYF@}4;;uG +G+EEę+EEPZ]<4ME}eEԍEȋPWWPL_^[jjZAjOH+4H3ʋMG+G+EEEJG+G+EE+G +G+EED3ɉHHH H0O Ë tT$L$Rh BUQQSV3W9^pu uPP؋NLtuCFxPu؅u1~hMWXPuPH؍EP_^[UTSV3W]9^X 9}NPQϋP;ÉEMBWVM?E~@EcP8P+XP+X3]E;EPMEtaEPEPEPSWruMuQMqP|P8P؋PK ]H+ى]E}uEuM܆E_^[3U$SVWM苆PPjM[SSPEPMK+‹F8HueËMF@ubE F8;]MCP8F<E+NjM ȉK_^[Ht3jX+EZF<;u=E+E }MGP8F8;w똃뱋EJ?UE V@Q$@QM$SuEEEuMEQuE( ^UlMSVW3;teu9uu 9u3+udu MMPEPZPMVuMQuP|EE_^[9ubuTtHPuuu uәUQQSV3ۋMWV;Ӌ9H$#ȃ- ȃ @QRĔ jvx 5P PȃPv u EP}3EIQuPuv _^[Ë3U@SV3W9s89,ty;to911M<jP0u SuPpM91{1_^[ USV39s8u 9s<1^[USVu W394OVuPHs9E7MMMM|EEEĉEEȉE̍EEԍE}̉EEEEEЋEĉEEȉE39]9CE ]2u SȅɉM@Pҁ@Q$@QM$EE3U]EEE9E( Dž@ EDE"UЉEEkd L UEE؋UԋEf9"E%K E(M܃eɉMf"g|XP MXPɚDžX E E ;C39[9tQEEEPEPu EEE؎EEPEPup_^[ 9銐9+9>F9Gu PsRhEuMzE؋E荍d؎$EPMdP虙f  dȐEpPMpPdE艽pE}t3HPu uu EEEEEEE;E܉Es}u usPlME؋E+9ESJ9U 39t';~luEPEPuM0u"} u ~huCvre}̋EO9 y,tt$ t$ t$ = t$jt$ UHVWv4NcRv4Nx,R_^ Vt$>:C3;C ^VWu]_3^USVWej_Wt?MMF +E2 EF+lj}}EURS_^[ËASVWNt'\$Ãt,HTHFj XPQt ^>_^[j UVqt6EQI Wx }x}x@}EEPV _^ 2 AAVD$tVY^SVW39~N ~^ SbG;~Y|F3@~~4tjFC@;|I _^[VM 耿D$tVKY^VL D$tV)Y^1 @M A@(B ATADVF0N P軾YF P豾YN,M ^VM D$tV軿Y^VD$tV蟿Y^VI 3N+蒾^V J 肾D$tVMY^VI N( jFT( FdFXNDZJu^39D$D$@ Pt$Y3YD$ڍH#ъ|  | @ Å`IofĻ'һ&&T5ݾ   MlpjTVt$Wt$NXjG\_^SVW339^0u9^uD$;uk;_^[j:-F0;t؋N\t,N;UQPRFf\;t PX Q^F0;tP^0Q덋PF0QF\9^F\u*5` jY;YV.;ÉFF;HF0QPR;N\@H3;VWoXF N jjjP_^Vt &^Vt$Fp"$WFpF<3;F8WWPQ Fl;uF4WPQ(3_^l$(SV3WV@~0N<;\$9PQF@NN4~03N@+NP#N\2 Nl^L Nx^hOOOO2 _^[ËD$A SVW;N达׷p$请h褷MBjd  @ _H T3T X ` d h l P4 F4 RT PRTjxdžh_^[VWjdVh躶 4,)hP5 F@5 _^Ã|$A, AV~fNy5 ^VNN07N855 ^U(VWQQ3WWWF觵MPNWWWMF AF(HC~,zPN0Y_^ËD$SVW\ 5` hYY?3\$h tS5` hx軵YY2l tS5` huYY2` tS5` h0/YY~2d tS_^[Vy `O ^V*(,4$t6 ^VW N詼N衼2 hP _^V pQ ^V(,7 ^UeSVWM豳j[SS@ SH EP\ YEYPjdž B_Pٞ蒮YQQ3̉ MP$Dj j\ 3PTٞX\dž`dždMEP#‰UAUURQ#ЊAAMĉ9EčPE@A+}EP PRTEPE AeEP PRT35` j߱Y;Y-2;ljEL2h EPuEP蜬Y5` j艱Y;Y1觱;ljE1jh SujNYEYPuiEP=YHP MP T P4 ٞ<  dž8 P Yj[ M>E_^[UQQESVWpjY3ɋj_jI3ۃƁ^K@JtYJt7Jt)JuM/JtJt@MMM!]M M]]M ]M]uM uu _^[ÈM]ߊD$aAD$AD$ A SVWQQS譯|$[y/WPPT@ PFH P8j\ _^[D$8AtjX8auA:D$ L$AtRRP Vt$W/N/T$ H/2G/;HHu;Ltj0\ L6 ^VWt$t$N?ut$ VϲYY_^USVWMƮu 3^uήM©_^[3jX3UEQfEVuj VPR^] UQSV$$5` h4 YY=5` jXYY$>EjjjjurҏMjdP$%EPlY39^[SUVW3ۍO SOK,( /覮衵臵,(pHLPdžT\`dhl苴|f'Ή,H[ F 8[ AP?j)YXIu039]u&5` j蹫Y;YAhOE_^][SVW~ ȱ3ۍNLSSqj`j`NXeNh^dЬjX^ Y3\ 󫉞_^[V詪N3h^ FFF^V脪NN8NT00_ ^U(VN诩N$ȲjdjdMx_ wPQQjjj踩MPj^U EVu NF舲EQ@$@QM$賲EM#F(EF(EF,^ VN虩N葩j Q_ $QQPPPQQjjj j^ËD$VFD$ PNͰD$NPD$F^V4N 芨N(N@ jj_ y^VWNNܨQQWhh_ eQQWWWYj_^ËD$VFD$ PND$NP^UVWEQQVhhGQQVVVu MEO(PSG_^VNNQQD$P_ "QQD$Pt$?^VW|$ ٍG#Ȋ NFGPNCNW7_^V诧ff ` ^Ë3ҹHH P@H HHHP$P(L` ø VW|$ (A>PD_3^V4t$j b^VWt$ 3;YaNF~ _^VW3at$H =p t$ P׋_^QSV؅p؅_WUk5` h 趦YY9 l+V۽9(u:5` UkYYa Ga ((VPl؅9u:5` UYY`a GPa VPl؅L9u/5` hx跥YYma _VPl؅9u/5` hPjYY1 #VPl؅؅(~ PPPPu6L$QP`t\ VmL$QPh]_^[YV  y5` hYYQ`>5` h訣YY PPP P TT^5` hYY<SUVW苤3N Xj ~n~薩NPTdžX+?dž\`džh=?P&MԋE1 M譆_^[UEQfEVuj VPR^]U,SVWPYNMP>WdžBWٞٞEPE裰EPEpS5` hމY;YHEuEP輄Y5` j詉Y;Ylj;ˉMt3F4+tgHtXHtIHuhhSыuPTEPbYj>jljS_^3[hhShhShhSUQQfA4QfEEfEfeVuj VPR^UQQfA4QfEEfEfeVuj !VPR^3USVW} +}39APMEEE_^[M3EU;QP}9Eu9ATE ~9Eu5` j u8YYǠ݇H sۉ]tMSu udEEPYE EM ;HTsM3VWVW$jG$VWj8$VWj)$VWj$VWj $VWj $VWj$VWj$VWj$VWj$:eVWj$VWj$VWj$VWj$VWjpV$Wj\$VWjM$VWj>$VWj/$rVWj$VWj! $,VWj$VWj$Vhxbj $VWj $VWj$Vhlj$$VWj $VWj }$VWjnVW$j_$'VWj"K$VWj#<$VhtXj&)$VhSj'$Vhj(_^ËD$)tT$T$  VfN Ѓ}L$ND$ fF 3^UVW}i}u M QO d q$V-}uu _^] 3l$4郋D$Vt$ p| t$ VP8^UVuWjMjQVP |=}!C4R{}H{jMjQVP |LjEWP Y3Y_^SVW9t$$  |$F$ G_^[S S4 =$ t SD [WVj =ܓ jXVjZV$ Vj$  ^$ _USVu W3;;gWVM6EMȉEEEs E}}?MEMPExs p}dfE MP&} LWQVP0;ljEgTfuMPMPMPMPMP MP MPMPMSMPMP}MPMP$EWP} YYu3MVt'eEPMdu(du M#etff|f4$ /,?t$,Y,M~,M,M,E_^[} @e,Vt$ D$jΉFs ,F^T$3ɉHPH HHHs SVW~ Wz\$fYF_^[Vt Nt$P<^39A uIËA39HVjt$ N^USV3W9s9su9sM QuPCC_^[]UVW} U R7FuPQ 3ɅE IfQNF_^]VGt Nt$P@^Vjt$ NU^Vt Nt$PH^Vjt$ N ^Vt Nt$PL^UQVEjNPEM^Vt$ VlzYL$h jD$^USVW3}i9~tEPF}u^E ΉE 39EPEPE PΉEtEF tX}}Wu΋t^ t"uVP΋t^ _^[}ӗu P,,EP跨EPsY_^[Vt$ VsYL$h0 j|D$^5` jXxYYVW|$ WJt,FHPFLP|FTPqFPPf谂Y_^UQQVEjPEMPEh# 4uu^SUVW|$Wt1t[^SnUu3ϋt_ t39^~F ύPC;^|_^][UQQVEjPEMPE # }uu^VW|$ FPVwtW =_^UQQVEjPEMPE8# uu^3V~ u NF F ^ËI`AVW|$ WqYh8# jg_^5` jvYY܋vUSVW}EPjuFwϋt_ t"EFt&@PGvHW0_^[]~ ~UQQVEjPEMPEP# uu^t$V5` j uYY=mufH ^VW|$ FPutWl_^L$t$P D$jt$APQt$ YYP YY<L$t$P D$jt$APQL$  Vt Nt$P8^Vjt$ N$^L$h# t$ YD$SVW|$3ۍFTPF8PFPW/YYPGYYPYYt W1_^[L$t$P D$UVuWEPEf}EPV _^]UQVF$PFPu*YYPYEYMPEMF^L$t$P D$UVuWEPf}EPV _^]UQVMFPFPFPEPtP%YYPYY]EMFA^L$t$P D$UVuWEP"f}NEPV _^]UVW}FPFPFP70)} BFPB_^]Vt Nt$PX^Vjt$ N^A@PËD$V^L$t$P D$UVuWEP%f},EPV _^]UQVFPFPFPuYYPYYMEPEMF^L$h# t$ >D$USVW}3ۍF@PF(PF PWYYP:YYPYEYPaEωFmt W_^[]L$t$P D$UVuWEPf}7EPV _^]UQVFPFPuYYPYEYMPEMF^L$h# t$ 9D$US]VWE~ WP~iE?Ft-FPSEYYrtS8_^[]~WSZYYEtȋ?tWVt$ VkYL$h# jD$^Vt$ VjYL$h($ jxD$^V5` hoYY#`a FPa ^t$UQQVEjPEMPE($ fuu^VW|$ PW!YY\tW"_^L$h t$ D$USVW}3ۍFtPFpPFPPFLPFHPF4PWYYP@YYP\YYPPPPFxPWYYPYYPYYP} YYEPeEnt W_^[]L$t$PD$UVuWEPf}ˠEPV _^]UVW}FPEPEFEPEFEPEωF _^]Vt$ V}hYL$h# jD$^ËL$hH t$ D$SVW\$F~PFPFPF PWSaYY.PYY/tS#x@ _^[Vt$ VgYL$h jZD$^ËL$t$P D$jt$APQt$ YYP YYgL$t$P D$jt$APQL$ %UQQVEjPEMPE uu^VW|$ F`PF8PF6PF4PP7YYP YYtW`_^L$t$PD$UVuWEPrf} EPV F_^]UQVMF PFP(PYEYMP"EMF^Vt$ VeYL$hp jD$^5` hxjYYnVW|$ 8PPW7YYPgYYtW`{_^Vt$ VgeYL$h@$ jD$^5` hP9jYY_jUSVW}PWmY4YP0P @P<P8PdPHPDPPYYPYYPPPPYYPgYYPPW YYPY,YP(P$P PWYYPYYP YYPYdYP8P4PLPHP\PXPhPxP] ~PWy YY0Pq@PZEP]EEPHE<EP3EDEPEPEP ETEPEω`t~ V W_^[]L$h# t$ BD$US]VEWP}utaˋt{ } FPNSgt39~~F ˍPLG;~|_^[]L$t$P D$UVuWEPf}[EPV _^]UQQVMFPFPFPEPEPEPPOYYEFMEFEF ^^L$t$PD$UVuWEP?f}-EPV _^]UQVMF PFPF PFPEPPYYEMF^L$t$P D$jt$A PAPQL$oL$h t$ D$SUVl$WF0~(^ PWFSPUYY5.Q$wQ$w$tU_^][UeV5` j0dYYQ$Q$Q$QM$sP v^S\$VW~(FWPS6YY}Q$vtSM_^[L$t$P D$jt$t$wVt$ V _YL$h jD$^5` hHcYY_USVW}FQtW_^L$hp$ t$ D$UVW}F8PWYFTYPWYYP PPPWYYPWYYPPWY`YPWYEYPgEFtEPUEFxEPCEF|EP1EEPEEPEEPEωtW_^]L$h t$ RD$ËL$h$ t$ ;D$VW|$ FPFPWYF0YPWQYFPYPWYYvtW <_^V񃾔D$$9^5` hp [YYo_^[Vt$ VYSYL$h# jD$^ËL$h t$ D$t$L$h# t$ D$UQS]VSt1EWPE~WSYEYPN70_^[L$t$P D$UVuWEPf}EPV j_^]UVW}F,PF(PFPW5YYH7} F8PF0PWYYPvYYEPEωF_^]V5` hVYYSa Fa ^t$3L$h# t$ MD$UQQSVW}W3ۃ} ]^kEPq^^] t E ;E>kK_^[Vt$ V5QYL$hX$ jD$^UQQVEjPEMPE$ uu^U} Vuu0} MPMVM^]D$A,Vt3t$ej ZB;{e;Je3^Q,Vt%D$ ee;d3^Vxs N(RNR^SVWGO39_u*G(w(P8~SPPYCP8;|G(O(PD_^[s Vs  ^V~sF^s  QINYÃl$4|l$HrUE SVWGaGPEH;_^[t t1GuNFPQFxt jN 3ULSVW3Nl};ω};u8Ft;u1Fd f9x>H9;uFlVtRh t P;;HFlURht Pj_#ljEHtFtPQH}u.EH3ҋ9RURPQ<HEۋuFtURPQ SHFx^xF|~|iHuFtURURURWSPQ  HEM+EQΉEE+E܉EPdtE艆E쉆N@UȍF@RURPQ}u8u/uuuuGFltPQEt ePQu j }t.}t(3_^[k3|#PQu uFtPQj FxߍND3#SWPQ F|;!GFxSPQv|;GmU V񃾠u(MDYEUR@M$E^U4u4 jjMOPEPuM裛țMMڛ}}EP4辛軛EPM诛EPMPxP0t Q$EPEPM蟛1PQ$Q$lXPM|l葛x膛M~MvMnMfM^EP4V4TP4ܚٚTP`P4t Q$4t Q$HWPEQ$Q$jP tt t _^ujPX t܋ujxxxxxxxxy yyy"y)yD$L$f@2f3VW39JWWv _WPxF N WWjP_^39At99VWl88|$ 88W +@_^l$(MVW|$3t&Wt$Г ot$o>_^ USV3W=p SSvׅEaoPQGYEPuv׋hEHNPH0NTi?@1ȉFXPIYF\3;o=h QQvׅF`t!PFYFdnPv`v׉F`Eډ+H`neMmQ 8t $ۀQM$}MPMsMUɍ#ʊ MEEQۀ 8t $ۀQM$+MPM^sMUɍ#ʊ MEEPO>Y_^[V39qqؑ ^XO ËD$@@UE SVW4d d @?@?uЋY?}?uuSSP_^[]5` hCYY%t$ s% SVWٍ3#QSt$džv džu džu u dž@t I($jjj;j:h% jjVjV Y3hV FPV F8U Fj$PY#Pd_^[ËQSV3WWv9;\$M8V_^[QVt$3;W?8J;Q=8_^VD$tV5 Y^V(i Fi !^Vji Fi GPYPYb^øh Vj D$tVY^VWPZ GF 3;2F;2F;2F;2F;2F8;2_^V~<t~@3vuf>u+jjFjjVWjj jU8؅WjjUSVWjj -WT ]_^[á2 L$PQVWt$ |$V_^ËD$ % PjQ ÃDSVWUhO5%  2  ;v%3ɺ NFV% ;wD$P f|$B35А  K@G}a% ;CtGPփtUԐ t%+zuK뙡 2 Pؐ ]_^[DjËD$SVWUP;-,3 D$H3 9(G0D$=84 rD$PU (2 3@󫪃|$3,3 83 ]_03 3^[AA84 D$84 % VWhH4 VjL % 5D4 8t5% D$ L$PQjjVSD$D$ P{ND$ L$T$PQPWVD$H=@4 _<4 ^ËL$ST$Vt$ WD$U|$t T$D$>"u+F3ۊ)2  t t tԊ@̈́t@3FFE>\u[ut V:"3ۃ8Mt6t\@3ۊ)2 F3>\t>"tMuʊt2u t) t$tυt3ۊ)2 q@FP밅t@>t6 : 1>t|$t T$D$T$ k|$t T$T$ ]_^[Ã% SVW3U:u]PL5 ؅8-% ŀ}uB% P]_^[Ë+р:t:=tFl$}t+щL$}=tQ ++;ȃ릡8 th8 h8 Zh8 hP5 HE8 x  ?  8? ?N  ÃD$SVWU^hD}  ؅Vh,} =( S׉D$Fh} Sׅ@ЋL$D$PQUT$ /|$.h} S׋&h| S׋3۸D$u$C |D$PPօ D$ ]_^[PP tD$D$ GAD$D$~PAD$t$L$l$\$\$u3hhËD$L$%PQÃV|$D$P,L$#L$ # VfD$l$^fT$3tttt tt 3fʁ )' %3fʁt t  f3T$tft t t t t ʁʁuth& ݳ& & & Ã=' V' j' Pj& 8 3& L P|38  FH9 s'Ƌ΃% ȃtu^VW|$|$ D5 % :WjPօ3_^h;hK jhK K ËD$VVFD$&FD$F D$FY^D$ # # 3h chK jhK # hgjjhK 8# hghK jhK  # mh hK jhK  QhhL jhL 0 5hrhL jh L # hvh(L jh0L h# h>h@L jhHL / hUhXL jh`L P# h?hhL jhpL xL hhL jhL / j*t D  h{YjHjH ' ËD$P á& Pq & + & ;r & D$& á& P< & PQ~ ʰ & + & & ȉ & 륋D$ % PjQx h`MYhіhL jhL L ?hE Yh|hL jhL H ] hYQQ1jjj hL @ UQQVW$E eEEmFEFE^ PN }H 55` j'YY5E~tuT5_^hhM jhM M hh0M jh8M # n h*Yøx PP h=Yhh@M jhHM # h>hXM jh`M pM h~hM jhM M  h|YùH' P' H' Xj H' P} ` H' h߱hM jhM h hvhM jhM  ihThM jhM # M hYhN h' VW( |$ 3 ~N IƉN_^QhYhhN jhN h hh N jh(N  hh8N jh@N XN hhpN jhxN N ~hhN jhN N bk hoY hYù`* I hYùx* . hYhN *  hYhN *  hyoYhN *  h[NYhN * l h=-YhN * K h YhN + * hYhN  +  hYhN 8+  hYhN P+  hYhN h+  h}gYVWj+ _+ Ou_^h hO jhO O h\h0O jh8O # nhjh@O jhHO # Rh˲hXO jh`O  6h%+hhO jhpO O hhO jhO  h<.hO jhO  h@/hO jhO O h@hP jh P 8P h@hhP jhpP P h=hP jhP P rh/DhP jhP P VhHhQ jhQ  Q :h^h8Q jh@Q XQ h^hpQ jhxQ Q h:chQ jhQ Q hznhQ jhQ P h:chQ jhQ R h/Dh R jh(R 8R hcvhPR jhXR hR vhwhR jhR R ZhzhR jhR PP >h,hR jhR  "hhR jhS S hh0S jh8S PS hhhS jhpS  hhS jhS ($ h˿hS jhS  hhS jhS  zhϺhS jhS ( ^hhS jhS S BhphT jhT @$ &hlh(T jh0T HT  hh`T jhhT xT h hT jhT @ h hT jhT X h hT jhT T h hT jhU U ~h h0U jh8U PU bhhhU jhpU U FhhU jhU U *hhU jhU V hAh(V jh0V HV  h)Yù %  } hhxV jhV U  hb?Y @| hhV jhV p qh_ hV jhV V UhL hW jhW  W 9hh8W jh@W X$ hhPW jhXW pW hhW jhW W hhW jhW W hhX jhX X  hGCYj+  +  ~ ËL$x  hsh0X jh8X HX S h,Yj+ + 0~ hh`X jhhX xX  hYj+ m+ @~ hKhX jhX X  haYj+ )+ P~ hhX jhX X  hYj + + `~ h#hX jhX Y Ch"h(Y jh0Y @Y ' hYj+ + p~ hj#hXY jh`Y pY  hyYj+ A+ ~ h#hY jhY Y  h5Yj+ + ~ SVt$ W|$ % WVjPӅ _^[hB$hY jhY Y  hoYj+ w+ ~ h$hY jhY Z  hTkYj+ 3+ ~ hs&hZ jh Z 0Z  h9'Yj, , ~ hk8hHZ jhPZ `Z M hYj, , ~ h>hxZ jhZ Z  hGhZ jhZ Z hoIhZ jhZ [ h Mh([ jh0[ H[ hRh[ jh[ [ h?Zh[ jh[ \ } hYù, g%, , x h\h0\ jh8\ P\ 4hbhh\ jhp\ \ hgeh\ jh\ ] hhhX] jh`] x] hlh] jh] ] hmh] jh] ] h[ph] jh^ ^ ht{h0^ jh8^  ph}hH^ jhP^ `^ Th9hx^ jh^ ^ 8h'h^ jh^ ^ hh^ jh^ _ h>h_ jh _ 8_ h=hP_ jhX_ p$ hghh_ jhp_ _ hh_ jh_ $ hSh_ jh_  thSh_ jh_ _ XhSh` jh` 0` Yùh, %p,  t, h, 8z hgh g jh(g 8g X hYùx, B%,  , x, z hlhPg jhXg V  hYQQ, U hyYQQ, P=hohhg jhpg e hfhg jhg g  hYù, ~ hYù, c htYù, H hVYù- -hhg jhg g hghg jhg h hhh jh h (h h h@h jhHh `h hhxh jhh h h(hh jhh ( rhhh jhh h Vhhh jhh i :h h(i jh0i @i h, hXi jh`i pi á  @  =X,w,4.N.h..hO jhp hp h0. g,ghxL Yp"%Y'\**=. u4WVx- n Vjjjj0 Xp r . ^_V395\- u25` j xY;Y;ƣX-  \- ^VNH{ ^à =j WVUShj jYYj^Vj HYYjأj _D$WPh\j jF;u D$i D$WPh`j j$;u D$/ D$WPhdj j ;u D$i D$WPhhj j;u D$i j!i ^VShj j- v3IQSջi VShj j v(3IQSՀ=i t;'C;u3WVYj YD$jPhlj j8u D$i Wj#YYj hi hpj j(j j j Shtj j)Wj%\Y j ;Yj 0xj u|j Pj VUi  PVU, hj VU%8j  9= j j uj PV8j Vi  Pj!_WV hj WVzi  PWV hj WV[ =j hj WU? hi WU0 hj WU! SWU hj WV hi WV hj WV SWV j D$hP u D$i j D$hP u D$i / j Shj jSjjYi YjjYYj]3+/ #jj|Y YwO$@Rj 3+/ #󤿬j 3+j # j []^_ ËD$SVWUw$D$?>LPjD$$jPV 3۾j  C k w=j tL$:tD$PSD$뷅]j Pj ]_^[ĐÁVW$?Ck ϊ: tP:Quy u3up$t (k (k  f@fB$t0k k ++$ʃk _^Ĉ댸8k ϊ:rD$WPzD$Ph(k D$P 3L$f,k Qhk 0k ?uk ++8k ȃS3V!WU|$󫪋l$E@3]_^[ÁD$$SV$WU۠fD$fD$fD$$t }Ơt E@8٠tŀ}f|$^f|$%5 fD$f|$fD$f|$uAL$j|$j@QɁ QPeD$j jP2fD$ D$- %PՅBD$j%- PՅ3$tD$$f@ fBtdD$jj@%ShPHjC@j@Ph3fD$"P#ߠj ÀD$S%P[ ]_^[ČSDl VWUt/5p Dl D$ L$T$P\$QRS]_^[j5p jjjօ븋D$ jL$ PT$ QRËD$SVW3f8UhjW"f-4f+=t$$|$ :|$ /|$ $$|$ |$ K+t$ D$jWt)σ0;L$ s39\$U\$ f}hWk=Puƃ1u -L$YT]_^[Ãf|$Ff|$?D$ Hl %fAfD$fD$ f#D$SLl VWUt/58 Ll D$ L$T$P\$QRS]_^[j58 jjjօ븋L$ VD$ uft$ jQVP^Ã|$SVt$WUSL$l$+ڋ+ȃ ?0FuNNG;r]_^[SV+WUl$+\$ȃE@8tPh jS%ŀ}tUh jS]_^[S3ҍ\$V9T$WU~9;++|$+OB̓9T$]_^[ÁD$S$VL$WT$0USP$QRP|$4+Q`D$[ j ,Pl L$ [D$$Mpl L$,|$4fBfA hl +L$(+|$ȃL$D$%j Pl D$f@ fBt-j |$j 'j ]_^[ĨËD$ hl 3ÃSVWU3|$9=Xl 19=hl hOh@h1h"D$3A@=|D$ hl PQ |$D$%1 ʘjFjPhWjufL$3f@=|jEL$jPhQj8fE=1 FM2  Hl =l Ș=l 5l ȘW-l D$P|3]_^[Ãl SVWU#D$5H Pjh  jjօl T$,uXl L$$D$ \$QL$PSQR]_^[Ã=l SVWUWD$5D Pjh$ jօl =l -D$$L$ T$PD$QRP]_^[Ã=\l Vj0j"VXl l PVl HNl 5l R| l Q35l ^SVt$ WU3f=l F PjWj"؍FPjWj ؍FPjWj ؍FPjWnj UjWj ؋EPF PjPWj ؍F$PjQWj ؍F(PjWj ؍F)PjWj~ ؍F*PjTWjk ؍F+PjUWjX ؍F,PjVWjE ؍F-PjWWj2 ؍F.PjRW/j VjSWj  ؋]_^[ËD$SVWUum|$3ۍD$S$h$PQVޘP$UWP "3]_^[ĀÅA$j$jhl PVo$l 91 D$ܘ3ɋ2 3fJt L$Ȁ0l r3]_^[ĀËL$ WtcVSًt$|$Et3~Ѓ3‹u2Iuރu 9K2FGuKJ[^D$_Ä\G.u3I;D$[^_ËD$S80|9 0@8u[À;ЍJр9u8xVt$w^SVW3395`l f=l ڐhl jWjhl jWj hl jWj ءl Pfl =l El  l  l l Q l l A l _^[l D 3ËD$S80|9 0@8u[À;ȍQʀ:u8ʐÃ=dl VɌhjV7m 5m Plm P:35m ^SVW3fl U3t$f=l FPj1Wj4FPj2Wj! F Pj3Wj FPj4Wj FPj5Wj FPj6Wj Vj7Wj F Pj*Wj F$Pj+Wj F(Pj,Wj F,Pj-Wjy F0Pj.Wjf F4Pj/WjS FPj0Wj@ F8PjDWj- FWj 荆Pj?Wj 荆Pj@Wj 荆PjAWj 荆PjBWj| 荆PjCWjf 荆Pj(WjP 荆Pj)Wj: 荆PjSj$ 荆Pj Sj VS  ]_^[à D$VD$ D$WP|$j#WjD$ Pj%Wj D$PjWj |$j Љ|$hB|$ D$8t @ B8umB|$ D$8t @ B8usBsBBD$P_^ Vt$S^Ã=j SVWUuhQ+j j j EMPj hN QjR k sqL ++ы=j +OʃM E1:Fz tP:V6z u3,zij zPj j ]_^[UEjPuh8 EEE PEPE YYVt$W|$'P۽Y0P軽Y_^UWuuuh8 &}3I_]SVt$ W33|$IуI;L$(|$3+ȃ_^[UEeEEPu u ]Ã=H u jH USVWh 4 =8-  3;f9P 9]uE58 EjPju;SPh5 \ \EPPhm P SP5 L PPPu<  PӋEP ~LEePPhm P PPP  PӋEjP %jPօtsP uxfPӋuIPuhm P PPPu PӋ u=8- ]ut; u=8- =m +j;^9t; u5m h D _^[US< VuuVӀ>utW= >\tV׋>u_u u^[]V׉EUQ=\- VxEPEq X- uVPEPY^5` hhYYYSVW~^ N8NP~Nhvk`U,|@qTf{ =`- h0 WYYh1 S YF8Yh2 PYFPYh3 PYFhYh4 PYYh5 PYYh6 PYYh7 PYYWh@ WhA WhB WhC WhD WhE ,WhF @WhG Tu `- 5d- _^[USVWMh3u Mu;u}Vj|M|닍ME_^[U AVt:9E 5AME PFEPEOYt:Et Mfu+u^t$q jt$US]eV#j YzM UW}ɉP8HlF hFFtFB_E^[]UVhw P+ .Vhx h+ MVh{ M3/ EEm e+ EM39ut,/ MP趴95i ~hm M耴F;5i |uEEjj@SZi PnuCW;hn /}Eu n Ph/  Sh2 i P uhm ֳWγhj ³8ME}E}|M h- ^_[ËEQhhp h' D$' Phh' YU<SVueeWEi Ei ى}EeEEEЀ;ʃ*A$/*Ik*b*I2*r'IN'<':i &:i &h/ MuHPu i$E:/ $:i $*  * PHPQu ${ %!C* HAG}M-҈U{U&;Y&egPK83_^[jt$t$t$t$UQQV395l- WS5` ujYY;YwEE, PuEP.Y 5` jYYL/EMWSTEPuAEPCY ~5` jYY EE, PuEPY 5` jYYχEMWSEPuEPRCY ~5` j6YYTEE, PukEP Y 5` jYYREMWS6EPu#EPCY ~ 5` jYY EMWSEPuEPrCY ~5` jVYYdžtEE- PuEP+Y 5` jYY1EMWSVEPuCEPCY ~ 5` jYYEEMWSEPuEPCY ~ l- [_^à V395p- ubWVVVhn  ;tE5ܓ jZWPjXWPL$1ЍHW#ъ$'  $' @(' ȓ  p- _^ U W39= h9;YEVSjE[sMuWWEVPEWVWPEVWWPEWVVPEVWVPwEVVWPhEVVVPYKttEWWEWP8EfEf@qu  EPY[^ _ËD$T$T$ QT$Qa5` jYY_I hXQ jhXp h`p h. U(SV5 W5` j}YY:uuuu 8]P3I=ܑ EPRVׅ@MQPjׅM܉HEt~uH E:@EEP` =. tu5` jYY#:΋xXZ{ ^~ t . EPVP8 . P/_^[j 3Y}`E[5` jHYY9. `벋L$HL$`HL$ H L$H pp pp h Q jhp hxp h. BhP jhp hp h . #h8P jhp hp h$. hP jhp hp h(. Ã|$ VWIt$ JY>j Y8V`-t$t$VVP_^ S3f=` VWd  9t$jY3_^[ËD$Vh F | 0 F^USVX% WV |MW聋3SSWujVSS u9]Yt EЧ_^[UeVW}t\5 EPhp hօuB8S t1EPWuօu#0PWu tEuu[E_^UV3u  @ E4Puu 8 EP4PVu uu4P, F^UQMS3V8W]tB8uuJ;rJG8tB8uJ8UtG8uO;s+ъ0EA;rU3;sAJ;rEj y3YE a;wʈ@ʈ@F_^[U(Wj Y3}h󫡨 jE E{iEp Ed E@DEEP` _)%i;;;)%;;;;i;;l$Uuuuuu u]UVu W;( j( Y3ջEU RujPQ|uE uuPQ(E PQ_^]Vt$Wt$0j9t t$NTqj\3_^|PPh| U SVEWP3 MQMQuVPu239}~+u'MQM4uVP| fEf;E tOG;}|Ջ5Ȓ 39}t"9}t9}~EtPG;}|uփ}t }tu_^[UMUWjX} jhX ETRQ_]USVW}3;]E ;vMEQ]  d QfHf@QP5d ( ;ÉE|EURuPQE9]|EURPQ E3]9]\E@.;}0EURVPQ;ÉE|MA@t EQPRTFE9]\u;\EEE 70P ;ÉGu\9]|P M ;ÉAj\]]EuPQTE9]9uE@.9EEURuPQ;ÉE|ċE@@uESSUSRU2PQ0;ÉE|u tlV詅SSVljuSS El@phP/ P EjPYYOEM @I@1u G9i[E9lt E`[u9]| 9ub[9]t EuPQLE;t ]PQE;t ]PQ9]4[E_^[USVW39}WWjuWW ;E +t6Hѫ6P ;ūVSjuWW f|s_^[]ÍFPW` t$ t$YYVt$V fD$ ffF3^UEW9DtJ|F}AVPMQP`tPMQPhj0x^_]Vh ^UV5` j,觾YYEMjLt55` j8xYYE+EuUEPVY^]jXUEVffAMfHfAMfHfAMfHfAMfHf@ fAMMPuEMEu>EPEPEPEPEPEPE @ PV 3^ 빋U SVWMP3SM9SSMZЍpҍ#֊@M_^[VWN3F HF NF@| ~~F8 ~X~\~`~dx _^V8A D$tVY^jXVD$tVY^AX| HF D$L$`@ @  @h @P @H l$l$D$@@UQQVeF\v?WUSЂ RF\F0Wv8PQ E|>Et^^(SWPE|&NQh SPE|f\ )Ef]} Et ePQE[_^!EUQVt^ÍEEPj h;tE SVt$ 3WFTHf|$f;j\f~: S0;_^[D$V3LjpYYL$ ^VW|$ ϋPY^A HVHF ED$tVY^VN|}r ^V8A SD$tVɳY^jXVANxB ^VD$tV菳Y^V񍎔 N|~^V8A D$tVHY^jXVw` ^VNx ,D$tVY^V8A nD$tVY^jXVfٞ ٞ^VNx UD$tV臲Y^V8A D$tVeY^j XVy ^VNx ID$tV#Y^V8A D$tVY^j XVD$tVY^VNx ^V ^V8A D$tV蓱Y^VWOcO[(  _^333V8A D$tV+Y^V, ^UVW5` j輴YY=9 t%E 9PΉEEP耯Y_^]UQSV3W]i}PWYY$E_^[ UEfMfHfAMfHfAMfHf@fAMMPEEPEPEPEPEPE @ PuM3UVW5` j跳YY<4 t%E$4PΉEzEP{Y_^]3VD$tV藯Y^VW <( HH( _^ÃVBH F ^VHF TD$tVY^D$V;FH^jXËT$;t j)V 8D$tVɮY^V 1D$tV觮Y^j XVH D$tV聮Y^U$ESVW3;] ;FMF VNEFUVE+ÉUPMQΉ~ ~~~~;ljE>39~GME_^[E ÉE~~uMWzPSWG;~|C;^}3;]}Ɖ]SUVW39LtE9t=9t5Pt~SGt LC;|_^][Vt$W3FTHL$fW0K_^UQESVW@THxu VωEz؅uAfE f;E~EHTu%Ef9X4tEf9E ~jd+SVPy؋uj\S0_^[D$SVW||$p 8;NTdNLWQ؅u)~TM_^[US]+]VuW3M;}nE ;QTU\;T9yP}};u }m}ug 5` j unYYH w}tMWu uEEP5YE ME ;E|EE;AP} UulE_^[U$ESVW3;] ;FM起F VNEFUVEU+ÉMQPΉ~ ~~~~;ljE=39~GM賸E_^[E ÉE~~WMuCPWSG;~|C;^}3;]}Ɖ]UEQ fEV uj VPR^]Vt$W3FTHL$fW0F_^UQESVW@THϘu VωEu؅uAfE f;E~EHTu%Ef9X4tEf9E ~jd+SVPy؋uj \S0_^[D$SVW|$ 8;NPsNHWQ؅u)~PH_^[U ES]e+]VWUM x;JPMj;E 39E9BTE~m}ug 5` j uhYY H w}tMWuu EEP/YEEM;HT|E E ;EE_^[UQeSVuWFTH } t!u  tEPu .xYYuFDuHPFBHPtEP蠦Yj\W0_^[L$3ҋATH@LVt$ f^R0Vt$WFTHoD$PPpj\UW0x_^SVWL$e|$YFL;K+W+NjP؅u )~L_^[D$L$f@Df3D$fL$jfHD\3Vt$W3F:NTHPL$@fW0_^Vt$W3f|$~F:NTHP2lL$IQ`j\3W0V_^UQEff@fAPMMEEPEPE @ PuM3Vt$W3F:NTHPהNTDD4L$W0_^SVt$ 3WF:NTHPJt$FTDwj\М_^[]UUARuuu uPQ]USVu33W9^tB9^u=FN39Yv,u uuuuPQ9] NG;yrԉ^_^[]|$u(D$nm m m3VF(PQ t$F(t$t$PQ^ UVuW3N 3;t89~u39yFv'uuu P}ut N G;yrكf_^]3I3;tPPPt$t$QRAUQVeW}$Q5` jrYY$fN G ^u}tMWPdg$E_^Ã>$5` jYY7$6EUSVEW3Pu jVuEPp |9uNu |lWLVVWljuVV lه9lt E EP E_^[UVEWP3 jWuEPp E^_^AUQV5` jXYYEjP"u uMEPӁY^USVWM3WWWW;ljEJPH;PD,PH؋Ή]PDKMGPQΉE~t.]}3]E3E 9E]jX;؉E;EE΋PD+NjPPH+EPu]]EueEvnevT}uNMUQ+MIQMQPLuuuuNEEP肀YE9ErE9}re}voevR}uLMQMQM+MIQPLuuuu|PEEP YE9ErEE;ErevwevS}uMMUQMQMQPLuuuuEEPYE9ErE9Er39] DE_^[9Eu+}tGPSEt2}t+39ECWPΉEt]ue뵃eϋAAAUU VRu uPLM t Mtj^E P~Y^]3t$At$t@L$ f% Pttt tujXà t3jXVW|$PD;sWt$LtG3_^VW|$ PH;st$WtG3_^j XËA,hgjt$PQ3UQQEeeUWRhj P|$EURu PQ|EuPQEt ePQEt ePQ_UQQV3!u9uvE^3Ã3UE VWM Q΋P`XtuXM QPh_^] UVu uV+ȸPtPuuVuJ^]UEVMWQ΋P`3;u;} tGMQPh_^]UVX Wjuj2E ϋEEP*uX uVuPx_^]D$;AtuAt39ADApڸQPPPRU8SVW} j0uPPEP<8@Q$@QM$uEM#MȊFEFEFP,j}E E0 ( Er؋]EMȍ{7S^KsFE x,E^s_^3[AH$_AËtV3St$t$t$t$PP6^U E SV3ۋ39LنdWQ$ن`؆lنp < QM$譇نd 8 F6QE $E QM$臇XE;9F@t 9E@ER;ˉPgD93;ˉTVD3PT]EEEEM]_eXPEMMX؉L^[UVttEE WQ@` $@`QM$蠆tM89PEtPuuWP_^ U MSVWPpu E E$P \ eE }EjPu uuY}\ET PEjPu{H\ E>0cLQQ$PuR`EE;Ez_^3[U5` }jp|YYu uuu]Vt$t$t$t$@ ^qdËD$tHBP4P8V,N fF\A N$NFF Q V(N,FD^UQA SVaLpaTqq p fI\uq$qfI^Wy^PY( ^ jfI`A8QyQ4XQ҂Pt$_^D$ VWT NXN\N`L$PpNXW^lN\WUlN`WLl_^U SVuW}ًMxf E$}Eu 3EWPu M^uup 9} EPEWPEuT N EQQQ$uu^_^[UVuu =d$E ^M ]L$D$ PeVW|$ WN\wgG y_^USVW} HLۉE N\!]ALEvGyLE3yDG NXWfN`WfEN\E;ALr} WuT 3PPPjPvX_^[ U$SVWM }샹 E$Wd]EPd]dd]EP{d]MAwXuNL33NDʉMAEAEA]A]33MjXE IL;v}xE 3EHDʅMbuA]uA]AEAEEE HL9M r}uvPuG\xLe ]K\qLE 3IDʉMA]A]K`qL~E 3IDʉMA]dA]`E 9} u_^[UQQeeSVuWNLv739UE;t3VD}tAS dENL9MrɃ}u} gNjMHpMHtMHxE_^[} 1GLPgEu9E uUeSVuW}EPWEN EN tdQHQKPQ,WtxSjQQ$Qفx$Q@xçN WPy,WDy(W8y$W,y_^[ UtSVWm*--x-MujQF$F Q$FQM$:xPMF Q$F Q$FQM$xPM蛀F Q$FQ$FQM$wPMuFQ$FQ$FQM$wPMOˋɉEQMQ$PEuu PE8EFjQ$F Q$FQM$iwPM FQ$F Q$FQM$CwPMF Q$F Q$FQM$wPMF Q$F Q$FQM$vPM~ˋɉEQMQ$PEuu PE8!EjFQ$F Q$FQM$vPM<~FQ$FQ$FQM$rvPM~FQ$FQ$FQM$LvPM~FQ$F Q$FQM$&vPM~ˋɉEQMQ$PEuu PE8F!EjQ$F Q$FQM$uPMk}FQ$FQ$FQM$uPM(~F Q$FQ$FQM${uPM~F Q$F Q$FQM$UuPM}ˋɉEQMQ$PEuu PE8FjQ!E$FQ$FQ$MtPM|F Q$FQ$FQM$tPMW}F Q$FQ$FQM$tPM1}FQ$FQ$FQM$tPM }ˋɉEQMQ$PEuu PE8F jQ!E$F Q$FQM$%tPM{F Q$F Q$FQM$sPM|F Q$FQ$FQM$sPM`|F Q$FQ$FQM$sPM:|7EۋσSP$PEuu P8!EMC}E_^[ t$t$t$t$UDVWM>Puuu u4M螢_^U[E荍`Pv]Dž@1 @puE jh vxP|QP`P]EDž {MQ@tuuMP=}]~|t"URSRS R}t"URS$RSRstURS$SKjX!EE0 u1E;p)pM`E( MVPL[뵅_^[VWƎt$tu t$ fEE( fE!E]t39EEEPu=EtKLE;tE3sDMVE]fF fEt]GLKL9wXE썍dP3E썍Pk39UtOLE;tEwDE]uGLKL9sdjPdDw9w3_^[ L$AYr(AT$ZABA YsA B ABAT$ZA֋AB A QLV3WvID|$ GYt F;r Gu_^UQS] VW3ҋ~LU;tCFDЅ3}GYVDGZFPfPWΉE 1M ENPuRCNDiVLR RP<^D׃ Oҋ#ъP HOHfO fH E_^[GYgG I GZWG J U VuQFf $FfQM$@Ep sEp s؞w*F ^M rPFYw[A^ wPjX^F^M sFYw1A^FYwA^F Yw A^v3U eMWVSExLjYMA3څ 3A3ʅE3҃}GDSVQRu?1ELEE;sMx} uE@PEM[^_EUMVuWA^3w*A^tUAZw B^v_^]u QVuuAZ~FZ~AfBaAfAZrUpSVWjٍu_OuMd>M\>CHMЉECLECTPE(  KLCPE~CDEuKTFHCHFLCLFTPE׃} ~~L~FDCDE}MFHEЉ~LP襃} ~~EFDjEYI( u_^[VW~PfP~P_^Ã#3҅…tL$V1pt$ 0^VW3F s|@F_^5` h4Y;YtΉ~ыL$T$9@VW|$ PFuW%P_^t$UVW3F96_^UVutUWS( KeuN72E9]vu ju@uPhu[_^QL$ F3Ʌ VW39vNWG;r_^Vt$WV3W ^L$NL$jttQt$t$t$RT UhM3MSVW9Hku9X\9PP9TDنp 8 M];M;( M}:M:u M}կM:]jˋMEVPEPE3E؋X;lj} M ;Tن`E؋Me;M܉MUEئd]EUنl]Eئp]sIE;Ps>UMRUЋ}RGuuSPHEeE;XU]EeU]rEE؋XE ;]B_^[USVu3WMنp 8 TM;Uنl؆`]2}EM] Ggu[P;Gg EMuQ[نd$EQM$9TPEvEC]۶S޶[M}uC]ɶ}ֶ_^[ UVu uVtQuuVu^]ULSV39X XW|HM} MM΋LENE|PuMMuX VuPLjdKV蕓SuTSqE E PS]MsV`^E荍P"\CfQ$CfQM$7EMP)^E܍PeeN utEPu7}W8uvn_^[UVu WMԍPQjhP@B( E مhٝhم`؍MWIuQFF 8 $FQM$6EMPRFMEEPR}tXE%0 } 8 833űMčRDD}j3XűMčRDD؋}MQMQFFEjPW 8 @]ME( -kxT_3^ VN,N0-N86t$5 T^jt$ h t$jt$t$t$ UPMSV39]Wu_i9^,ViE_^f%$[ V3W9Fp|$ uWPPNLauWPH_^VD$tV(Y^V8 dž( rigiN@_ih^=======h  | , f=` VW=( t` f8t)f>u4. &=8. &_^ËFfxHt5 pD6&-P<.  *b(KNahH a&YÃ=\- thX- L&%\- YVD$tVk'Y^VNH{ )t&^VD$tV5'Y^V3{ 9`- t95d- u d- `- T &@%,%%%%%%3((((Nh(NP (N8(N 'N'%^Ã=h- H* &`* &x* &* F#* <#* 2#* (#* #+ # +  #8+ #P+ "h+ "+ "+ "+ "+ "%h- Ã=l- t/,  &, &, %- %%l- Ã%p- á tP̓ % Ã=. t)Vx- t P̓ &. r%. ^áL. V5 FH. F=. F^h. YUQS]@W3I . Vte3P8~N . EPW$N ;H . URuPHtj . yt!5 p( ^3$#Y_[ÅtjPT%. V{ #D$tV#Y^h. Yh . Yh$. Yh(. Yh0. YV%D$tV#Y^UQ  Vt7P8Nx  EPV%Mtۼ  tjPT^jjj Ã=. SVt$ W$% |$\$. u?=& t$=& 9=& wtЃ9=& vh. h. Uh. h. CI$_^[.  . - $. s . , #. T . , #. 5 . , #. u . , 0 . u . ,  .  . x, z x, #/ > /  (y  VNh| 5 ^. , . h, 8z h, .  . X, y X, .  . H, (y H, q. u . 8,  .  . , x , .. u . , x . u . , x . u . + x . u . + x . u . + x . u . + x . u . + x . u . + x . u . + x / u / + x / u / + x / u / + x / u /  X| /  u /  WVj+ _eOu^_/  w / h+ A/ v / P+ #/ v / 8+ / v /  + / v / +  / nv / *  / @Ov / @*  /  0v /  * o / v / * Q / u / * 3 / u / x*  / u / `* y0/ u 0/ H' " 8/ u 8/ x  D/ u D/  0 H/ u H/   L/ u L/  '  M=. "SVW3U9' ~& & 8C9' ]_^[jÃSVW3U3\$9' 3t$&  (uG;=' |Ã{]_^[ËA tڃ+Q tCVt$VF @3^SVt$ W3F Ȁu FF_^[Åh PV% u & r^P}% Pܐ ƅp T;au@u =8 -q ٛݽ`aAHݽ`aݽ`Ã=q uJq p t)tf9]uP3u 9]uP#;ÉfVjP s FE GPSSSSS tRP }URURuuu WPQ aaP4auURuuu WPQauuu Wl au|$ t jG|Ft$ VPX3Ʌt|$ qj3Ʌ3fEP 3P4;` Yh V4 f=P% uh jh?t fP% VD j3h WPE 'PQnF4Wh PnftPQnNFPQFxF4tPQ vpVP|=~B~4MPQȍqȋR`;j¸x@n]sȋPC83;tPQ$=@?Cދd #u p txVCVxd jpWW xEC܋d @JPW5`  ;׉Uu+9xtEtxW5` Đ 陷C܋d HJ;~@L0IuKjM W4 Cjj5t d 5 @JuPE Pjuj֙+3PS֙+Px P\ WED MSsu5Đ S5` 9xtEtxS5` ֋Eö@Sh Q&EPQPPQH|0ft #PQFlVtRh t P;hZ ujhZ Y3'=, tj Y3 D$ @ Wf\MЅe@u;hZ ujhZ Y3u E3_SPWQje/jV/83 3 l$t$UWVЋ3]_^[ * 3TUWVЋ]_^[3]_^[3]_^[3]_^[3]_^[3]_^[3]_^[3]_^[D$ D$L$PQUT$ uD$D$D$PP 0@D$HQRjl$$VFŋ\$P-P {-= t$VW0000΃;|؋ԋC8uCD$ PWVU,]_^[ËD$L$T$PQR ËD$L$T$PD$QRP|+V P C. V jH*|$DD$D0x7|;5 2 ~Y% hE 2  ;v 3ɈH@@ U;w;5 2 3it/t*PԐ tŋ̓%  ʉQEG;&뻋5 2 멀K@!Kj K)j <)$j-)t@FN=F>"t0t*3Ҋ)2 t tF@t@F>"ut@>"FF@F43]_^[u+3]_^[Ít$8D$t,Ft%33Ҋ;r)2 A3F;s>uԸ)2 @=rU-,3 *(2 3@󫪋L$It1Nt*33ۊ;rx )2 B3ۊ^;s>u@rU-,3 9*03 D$@P3 83 @L3 ]_^I3Z[JÃ=84 tW*3]_^[ø]_^[84 % u84 hl X ؅t2 |3]_^[Ë|$e֋r3]_^[Sd3WT 3]_^[Ã=2 u{uX ؅u 3]_^[Ë;tE}uE}u+EUD$uS 3]_^[Ë|$S D$]_^[3]_^[    LD <MGD$WP,BfD$UP-D$+f3fD$PB-|$8cCcD$3P-c+D$L$PQ]eL$UQeT$OQR[eL$G 3@PQe~cD$P,L$G L$PQe_Ic uT$0]_^[N>9u 0N>9t]A_^[f<3ffN؋O ى_ffFGE^_ffE^_Ê v ڃ+ʋȃ$UE^_fFfGE^_ڃ+ʋȃ$U3_^þVK13FGItt uD$[^_tGIuu+G3҉3ID$Pjh  jjH tl 3]_^[Ë5D =l 3l$(|$;u-hl D$ jL$ jjjPQh U ؅u 3]_^[Sju 3]_^[ËD$ jL$ jSVPQh U to]PhtYL$,u Xl D$ WT$S,GVfERfEQH f}D$t;f}u3D$ L$$PWQ VW}D$]_^[D$؍D$Pjh$ jD t  3]_^[Ë5H l ux33|$(;u=hl D$ jL$ jPQj W t>Ujt-D$ UL$ VPQjW tL$$QPD$ VPD V]_^[Fn\x]fD$g]fD$V]9\B]9]30"$"N ]] ]1|9 \8D u \Ã0t t$\\j3P%p\FD$D\\3"$l"N \w\D$ D$0|$u0u FL$0t=1 ~.j3P-%t0|$s0ED$L$]F3ɋ2 3fJ˃+:[3"$"N [[D$0=1 ~j3P$t[3ɋ2 3fJݹ t$[F1D$|9 c[Ã+t-t0t* t$D[:[D$(([[1|9 [Ã0t t$ZZD$,0uF0t1Z9Z ZD$,3=1 ~*j3P#t1ˍ|AЁPF3ɋ2 3fJпQ=1 ~j3P@#_^[fD$F~> fF ]_^[fD$T$4B9B9]F_F^[ËD$$fDfL$yAf|$\$ff|$fl$tCD$P3fOu"L$\$fD$D$ Ff|$]%_-F^[Ff|$]%_-F^[jX 33@+P~ QpP~QmP~QjP~QgP~QdPW5` Đ ~8YP^QUP^QUP^QUPS5` Đ ^8U ‰A,h|1$? 3PQ,^b镚h|1鈚b5` jY;Yt"2)PVV*;ÉF uHb3Pu N,3; F,bu$F, aP^ QaPQj5`  魥ϥ@;a//F@N3;^HnuSWV@E G;~T}5uSWV@} u u9E ttu RXuGEƃ}3nFHH;%nC;nuSuV?E j_9}~:uESPV?} u u)9E ttu RXuG;}|C;^Hm량}E@PEh4t P M EP3;^LIuSWVq@E G;~P}5uSWVZ@} u u9E ttu RXuGEƃ}FLH;C;ܙuSuV@E j_9}~:uESPV?} u u)9E ttu RXuG;}|C;^L}량}3~EM MzMEMү3B_38EM@8U:3:EM$;MEEMM鷭MEMǰMujXE}u/}3M}IGIQWPB`/  E}uj^u:i t&:i t > >E1>9ut M#>MGEM}uu>:i @>E=9uu `/ MG};ujXE=} I9M} +V}ȃ^E "3IhTt j!_WU SWUy hXt |HtkHt>H%`t 3S+m ы#j P0 3h\t +/ ы#Ƌ3+m dt 3+/ ht 3+2 lt ¿pt tt 3+m j 3T+jX3aAK?Zh$#`hNP Ȁ@N 3ɈFNF6hEPgE%FgfFf;Gu:QQGPNt!QQWNwtjX3Aj^5P [PVT 2AjYEx|RYYY PP HtH*E6E*t$ NQu+vF_QQGPNr jEZE+t6It+ItIt It"ItIEEUEEEA ` A d ÉFut$\$VZt{D$jY@Q$QM$/Pu馝EuM]P@ @Q$@QM$>SWQQPH,EEPQ$EQM$EePQ$QM$vPdPP@@Q$@QM$.>SWQQPSd!,EEPQ$EQM$EePQ$QM$PH!PMO3=3G3N3333ߙMgF TgËAWPPS蛖ES?|E~Hu?uvEu.+;~7P!SwSL3_F T'_9^L05` hYYt"FL0L0331L0NLP<0H/EF<;u+E+NjM }ȉOMP8F8t7;u#uWu͋+뿃u7,;uu ;uu uu r+auE+E CTu苆څFxPWڞP@ Ehu P$EE x Ehu P$EE x  ؋F8U􋆼U+++eE؋E;EPMpMM0E]ЋF<Ӄ++™+++ˉM܋EPEYEPEPEP軘}tajMjQMQP|uE)]ău+EE9.u+ÉE끋EE8( EE}PX$EmP؋PK ]H{jXfs9^HsMMNLE2 ;ttUukNLEWPGFtMPP{H@MEQPMeEMEЋEEԋFtPPLH@MEQPM6EE܋EEM+EP+EPF|Mԋ@EQMPEMPEPFP NprpMMC؋P@ ;~E8( 3rhu P$EEE x rNLEWPFtMPPGH@MEQPM1EMEЋEEԋFtPPH@MEQPMEE܋EEr6xGՙ3qpVVVPphYMd;}M\PM?MGt M:u`E+EЉEE+ẺEMq}~}EEEEEeEEEEt)E@E탥h|E+EЉEE+ẺE랋E;ECEEu)YfEu>YEulREEdd|'d>ddEEM}/E``+EEuuMeMM^|PMXE M PMe@N ȉME3;EMM`E tE t}u E;E0}E;EE;EE\\Ee}EXX+EE5` jlYYppp{TT|uu|EP|llPD|P3{YE t E u?u,YfxE u E;Esx u u!YEEEEEEEeM}EE}EEe}EE}eE`MPEPE M P EE3;EME\S}VE;EJEE}:e1E䉅X6TiMy~}tF8N8PLSu TQdPP诂@Q$@QM$EuE̋EEЍEPWE( j@ωEP0u MMQMQP@MQP4uQ$UPuQ$DPMu Q$' PuQ$PMbu Q$ PuQ$PM0F8N8PLt\EMȋEQMQM EM+EPE+EPvL;EpPEP?PjVEהFM܉EEȋEQMQMEQ$EQM$'EM+EPE+EP{EQ$EQM$EPEP:EQ$EQM$EQ$EQM$EPEP(HP8j_tEjY+t2Ht*+tHuE E_$ ^E ME֋EM;VuQ蘿PEu+E䍍P肿PWd} EEMVQu8U APE+E荍Pu+PE Pd!E}8uEM܃ȋE;VQMQdPE+E܍XPE+EPɾPWdt[EM+E܋;VPEQ衾MPEȋE+EQP腾PWdtEHte;uVh QPlEʋ;FPQQ0VPPWl΃uVh Q뭋;FPQQ0V譾{PPzEu+E䍍P訽@Q$@Q$%WPHkmE( +E tPuQ@Q$@Q$HPvEMuȉtQ@Q$@Q$HP(EMȉQ\u赼@Q$@Q $2 PH} \nE3H0QQQP. PHPEMQu'@Q$@Q$WPHkE( +E DPE+EP̻@Q$@Q$IHPEM+EDPEQ z@Q$@Q$HP} 3E3H0QQQPE,+EPu@Q$@Q$WPHjEMȋE+E(  QP,覺@Q$@QM$&EHPEMȋEQMȉuQ[@Q$@QM$EHP} uu!E3H0QQQP39Ut3u|RHP2MQHQF4;EF5h E F6QQ0VEo<=PPWlEDž< P8( t6Q$Qh$PP#hE}E8Q4߭4= ؍0$QM؍,$|م0eQ$م,eQM$ZE Q$E Q<$5ˉuP8uمDٝDM+UM UR+MU+EU ERP荸;h QQPpPEPDPQE$ Q$EPQM$*tMDP腔uj_K3Df=:]Me]uEjPLGE;EKL3SDQBe$BeQM$\EQQ$EQQ$mUEUKL]E3SDٍB#Ȋ MEBEfB 3fE9UuP ;tAEZuEZu E%X ]E썍PmGEuEEM h 33PEeQuM$QXM$G@EQ$@EQM$+EMP輨E39UEEuEfEfEuXuP ;tAEZuEZu E%X ]E썍PxGũ} D;DMPEujPP2btMDPu jX#3EhLPa_L;t C3ʅtH33GDD\`bBYQbKSE/@b3뺃L=bE5b3|bOL;tA3lPPWDPEPRSdEPEPlPPPEPSVhuEPSModMhMMMMMNM؋NM lb3]c3c38 uCPVeYY{$ EC$EV!Y8(u@V!YC0PVYYV!Y: i uj@VC0K0E!YEPVYYV!Y: i )@V!YEPV]YYučK(uuK0e{0}w$Yr3PP-hjjK(ǸPPjhPjPjjhθj벋EVV[vK t-t(t [C EEGe}5C݃{ uC { !{b{ uWC{u?uYuM#tP0tF?uDGE0EGDTDT}U뜃}tBC븋軜&}ICGj}Y;E<0t <#t94M~EЍPM&EEEEE؉EEن E表EM+8f"+fEEنj+MEEPP<_5` j4蛕YYEQ$EQM$EčMEPPQ<V1E~@}WPRDEP!Y~EEEEEԉEEe 3믃eFjXNej 6ej DyHAlDj D2g%g; gا(u f |5u f |&u(f9 ~~4tuf9 } ~4uدEm U L s] }f94fEPKEtEHEEE ] nfFHtjj j| *] 3 jXjR jF 颀D$yHYPj) vjXހ׀jAd рE E ;ECCEȃ#ȍ;CjK C3ÍFXPFPP33} } EP3FdPF`PFlPFhP 05` hqYYt#E u kE PSY0e jXËA`@X@P,L =L 0>;ujX$cc3cjX%ceEbuF@;bcb3u:uu3M3M))@HGPQQ$NGXQQ$FO`H FOdH$zp蓟]jYpTdPpu EpPGPuEpP5PjEQ$EQM$7EQ$EQM$!MEuMMEE؉MME( QMEEQjSTo8HtH69qTt  9qTt  ]  ]2jX 5` jŏYYtKEjh SujNYYMjQuPdEPY3;t-9_t(u WZE9]FNSSSPP8Y3U;dMRdMdMdMd]e&=eF0F ^ h^) iY#,3øZu+{3>AM3W3 . GP8;#flf33EL鱱3EMPKh QQҍMPEPt"tI33uEL p}EP$PMPMV $PMPMPM {PPPPm?PPP L* P覻PM F ;0%pt39M9M9 t7t,jX;Et(CPESEu3S5Eu^E~jFjPjZjd33L^3L3L"3WLi3L3L333+3=P飶EPEWP蟍pHEMPEMPEP蠸EȍMPEP#Wc]xPh钩钫3ËPE-PR_r,obE,SGYYHP4YY93s V؄`}tugjXB3ÁLV裄Y35` j 脉YYtHW3PLP]镹ҥ@333.L;]}9];9]MQSSPL;Mu PDEPӃYsu EPqPMF6EEEEh QQ-x"DPV)xPPWPExMPoEMPlPPMPM{EMPEP|qLJTP8uP螊oETMPF6EEE]E]E]E][F4E QE G^LGG e J ^PFPE$FLEQ|$|M#FXEFXEF\FXGF4E E GVLE^XjF4E QE G^XG^\F\e$FXeQM$iEM#FLEFLEFPGF4E QE G^LG ^PFPE$FLEQM$ EM#FXEFXEĉF\G GGF4eE Q J ^LE G ^PFPE$FLEQM$詎EȍM#FXẺFXEF4E E GVXe^LG VPEV\_ 9E܉FL=EFPAEFXEEF\I^P^\^L^XN} FDPF?FPg GgWM] Gg GfXFPɉEU vo] WM=FXEGg FLgU vK] WMFLEGf\Gg] vWMF\EEԋP3uE M@a]EM@a ]E\PEPPEPEP E M@a]EM@a]EXPELPEPEP pF T33RL3^33xL3^3Ë+ \ +\ M%;G9TT5SSM蠂Ёp#֊QQ@AE ou (j] ]z]PO@tOPPf$lT@P齼HüP;@DA333C3P RPT銪 RPTEPW;ÉEIEM܃pPEPEPW>9]!5` jY;Yta6E9]uWELEEEPEH*EPE EuH@PTEP|Y]Et!;ÉEtMP0EP|YEt9WuY;YEt'M9Y~ hv duMEPH|YEtaMcW6!9]t&X ]ES]SQQ$PWuVu Rp3ۋM9Y~ hv dMEP航M(|EM聀E fMM]E G ހWMQMQMQMQMQIM9Y~ hv cMEPM{M{aQQPhQQPIQQ@ P*QQH Pf Se郸3jZj2j\ 3]3]S x%3É]EC:EESU1e%jLu\DF`\P jdMHhM$"SP/E썍PjE _P} EE P} \PDMV¬EЍPMu|Qj}jWMy襽\mʅ0 Q$8 Q$8 QM$M @ a Q$@aQ$@aQM$EMEMEMs3K3w33D$Ln33&383Je3 ($P  EL13wmMeTELR33D$jj3Ã0X@c3jP|YYt1vD ]p5` jH|YYtvp`N3GMPp3E EjP uVuC ExHu,t"`LQQ$uVP`F;u ZtmwnjZj^R3~hs Ppu(t$ t3u(VSdu$VSfxE(axxx333Ëv tu<u tjXiiPE3AyE33A]E3PEEPEPE PQ$.MfA]_E3PEEPEPE PQ$.M6EPEEPEPE PQ$r.M EPEEPEPE PQ$I.M EAE3[EAyE3EAE3EFXHPɋusLiENX+CLPEZ 1|N\eyLv`yLE3yDG tov`|vXPuuS,|N`WdEN\E;ALr} v`|vXPuuSF,|3W|-de(EjP uuuuEP tN N EQQQ$u E]EP N jE(eE]UC-tH4RQu wRQu `ǍMPPhMQu 5ǍMPPThMQu ǍMPP)hMQu ߿ǍMPPgMQu 鴿ǍMPPgMQu 鉿ǍMPPgMQu ^ǍMPP}gMQu 3jXWSuvPT տV/iFjMy gMQu_P\Phu;  P\ GP\EtMPhMPX؍EP2bY͉SP`*{L$jP {{!{yuEMP` 33 323X3~33333<3b33333;оPHƾP9BE };F3PP$W WP`9Ή}PP;߉]W=$ PSS EjEuuuӋuP`}jjv, 陻<E釻EPv MmMmEMԉEEEEE܋EQEuE2 EPv }%j?ÉF%V";ujmEuwE銣E鋤lS5` Đ 鈤E@钤;t,9_t%3;~G;tPȒ F;7|wȒ E 9@;tPȒ E w/ s uu ssEP׋3лS uWV M鼻_3eEP^YL$jQDÍD$Pj^ j3PF$tVPy]_^[ĐÍ@]_4j ^[ĐÀ~CMr~_Crh VsD$+8;D$j SEVP u}+I;t D$k vD$hL D$Pu D$8;ug|$2D$VL$ PQL$(T$$D4( QRxtD$t$>t F>!|$t!1]_^[Đ3]_^[Đ3]_^[Đ3]_^[Đ tA:BZq Bq3Jq3q|$t]_^[Đ3]_^[Đ螅]_^[Đ3]_^[Đ3]_^[Ĩ3]_^[ĨËD$L$Qj !BL$(T$,3 Pl hl ]_^[ĨËD$PAx̅3ͅ]_^[3_^Ĉ38Op$$;CHt f fJfJ$6q_^Ĉ tP:Q8q  q3(q3_^Ĉ3_^Ĉ<.u6}?t.++|$ǀ]3_^[3h URtf\=u)@}$.tD$WUP"} ,tJtFl=F뻃u@}_t D$WU@̓u't,uD$WU벸]_^[3]_^[ø]_^[O| ~-t?D$D$VL$$PQj jZ^hVI7D$^ËD$VL$PQj k^ thV7D$ ^ËD$VL$PT$QD$RPj j^| ~-t?D$D$VL$$PQj j^hV6D$^ËD$VL$PQj ^ËD$VL$PT$QD$RPj jN^3j誆LD$(\$(hV6x ^ÁD$T$QPRL$8T$4D$0 V$QRL$4PT$HQRj$^ÁD$T$QPRL$8T$4D$0 V$QRL$4PT$HQRj8$^ËD$VL$PT$4QD$4RL$4PT$4QD$HRPj$^fL$&ffuD$$u'|$ u fD$.f%f=uHD$,u|$(t7D$(D$ D$,VL$,T$($PQD$4RL$HPQj$^ftf=thV4 ^ËD$,VL$,PT$,QD$,RL$@PQ^3/8à q83Ɋ8$ Z8΀O8G8?878*u*$dPD$88؃D$48D$4ˍLQЉL$47D$7*u)$dPaD$ 7D$7D$ˍLQЉL$7˃I.73`$L$`86ux4u$`\7D$@3 2 D$<DAt)D$($\PQR?$l $`D$($\PQR? 6 6660u$dP/ePD$\P}D$HD$XD$l7D$L 60u|$t\$$dPD$u } D$l$3D$<6fEf6PD$P6;6΍$dPet:Ht3tD$<8L$6D$<8L${6} D$+эy]6@ $dPD$$T$(@|$$| |$ D$ L$$؃D$,فL$0u d$,d$0|$D$|$0u|$,uD$8$WD$D$L$|$0u |$,|$ ǙD$,L$0T$$T$ \$$SRQP_X0L$0D$,T$ l$$URQPD$,9T$0~\$DD$L$녍$dP˾L$, tfD$H5ƀD$D$DƀmD$0D$8D$DQD$Q GD$D' tE@$dPtD$$T$$0D$ D$$@$dPtٽD$$T$$ý뿋D$ L$$D$,L$0-$W+|$D$3D$80u3GL$D$0323g)3D$3|$`3D$XP  M3D$YD$\3 D$\|$u } D$|$Kt ?tGKu+|$'3D$-D$8L3D$+D$ 3D$($\T$ PQRj0E:n3q3\$oÍL$fPQg3L$($\QRPD$ P:MA3뺍D$($\T$ PQRj 9~1;CNV^IL$RQE9USV9 };9A9p5ݕzUs+ 6rVWlCv=d uuz{ tu}]r\SPlCPs _^E5f 5DžrD$ D$F*1^VwV4^m m m Pwm P43m ^ø]_^[ËFPs4FPg4F P[4FPO4FPC4FP74P,4F P 4F$P4F(P4F,P3F0P3F4P3FP3F8P3Fs8 zuK$SSSPV_;t1U/;t"j$UWPV_ft WG+]_^[ĀW.+f]_^[Āj3D$Pw!g]_^[ĀËt$ jQVP_^-FL$_W_jjjj8 t ]3]_^[ãDl |$$u=hl D$j\$jPS8 u3]_^[U.u3]_^[ËD$UVPS8 tD$ u&jjjVjW u(V*3]_^[PD$ PjVjW tV)]_^[jjjjp t ^3]_^[ãLl |$$u=hl D$j\$jPSp u3]_^[ÍmP-u3]_^[ËD$UVPSp t%D$ jju)jjjVh W u+V,)3]_^[PD$(PjVh W tV)]_^[f}jW\[f}t$$[f}[f0t D$ [fEf=xtf=Xt D$ [D$ [f0[fEf=xt f=X[f}[Wȃ7[u+t$ ;[[L$tl$3[[w "t [t [[)[[L$tD$3]_^[P&F&&  8Q~' & 9%j%^ø^ËFP$^ËF+؅i&SPFPտ ;uF L&F A&N 3&%%Q%%D$w%t$z%D$|%3Ã=Xl t"D$jL$ jPjQj_Z3Éuvwewewe2xeuxexexe:yetyeyff7ffNaNNPFWFj X+Qt$+‹QFG;DDDIEEFuWE3EN[E9EEEW؅~NTE!MuG;FE}LV!E];^|)FEE0DMED C3B3)CjLB3Lju1rRP`3lLl3FNLPN%8O F ~~F ^и(' ++" -" ^á"  " ; j " -" ^иX$ ++ϡ"  " ;! t! x3ҋ" %F )5" +H" u " zF ^P " -" ^á"  " ;u% +и% ++ " -" "  " ;u" +^и" ++P̓ f+3`E3VFF NMENj[Mdž%WPUuƐM8CHPWM= P<ME Q΋P4juP$i}E }xth PWXE}H[G FQ$GFQM$FIPHdG FQ( ]$GfQM$IPHdGfQ]$GfQM$HPHdGfQ]$GFQM$HPHndMjVHh P]`HE}-uu u&jh Pu`Eha3#be`hLPajXELVFwK}E&mE}ĉEEȉEEEԍEEEEE}̉E\m"نM MM  ن$ P M M ImE&nEVpt ;MdpU sBRQsPlEEtp9U OpipCoMf}t7f}u=E URh P}|%N`WuDEPQE3멋E83 VD$tV(Y^3 Uh} uMhMoWVjMu MeEԍMEEEs E-M1uEPExs bEωEPbEMhdPMhPMfRPMfRPMfRPMfRPMfRPMf RPMf RPMfRPMfRPMfRPMfRPMP MP $Me E P(jMu P} t u  MuM賳PnMMM^_(VW|$ At Cuj|W`_^D$tL$PQ3D$ D$t$HX螪Vt$Wt$NX jK\(|_^|$uD$4!3333SVWf  utP t$D$f 3p0=PPhw Wzf!"_^[US]VWf #fts} #f w7=PPhw V:zf"#fu5t+MQP wE7P t hpw VyYYf u _^[Vhw VyYYtP D$f f "^hw D$ QPD$P@VHPtttn t$;tUt] ;tDtP ;t3tC ;t"t6 ;tt) ;u j x^333333փVD$tV#Y^D$L$@83V1D$tV#Y^UQeVuWuu5` hE'YEYtX~T0N(#MP#RWjUu%E EL u0Wj_^3ыPQt pM 3UQeVuWuu5` h&YEYtX~T0N#MP#RWjPu%E EL u0i_^3ыPQt pM 3øPPD$ h 0UQEVW3pTE~>SWI؅t(fE f#PLfE f#P葬G;}|[Ej\w_3^D$HT׺L$f3UQeVuWus5` jx3%YEYtY~T0N,P#MP#RWj>u%E EL u0Dh_^3ыPQt pM 3UQeVuWur5` jx$YEYtX~T0N#MP#RWjKu%E EL u0g_^3ыPQt pM 3UQeVuWur5` jx#YEYtX~T0NH#MP#RWjw@u%E EL u0f_^3ыPQt pM 3D$P@QAL$RP"D$UQeVuWur5` jx"YEYtX~T0N#MP#RWjUu%E EL u0f_^3ыPQt pM 3D$@T>L$f3USeVuW0ft PPh G|EE_^[FTu H u 5 օtՋCeECeEEPjj t }tEP֋EE;E}EE;E}uutt3fEF]܋}EPEPWx EEP EEv |TW WTjv3VV T ;t fEE9TtEtTj5` Đ jEE}} W| E f xËD$Vt$ 3ɋPT9HTuNQ0c^ËD$L$@@3L$V3|% D$fH@4$ HT^|PPD$h| 06zUES5 3HHV]HHHHEP EPuul |wjESPEPp |bu t(VaSSV(juSS j@E(P 9(tEt(S5` Đ EP MEPB^[ÍE]Puul |bu t(VSSV(juSS j@E(P 9(tEt(S5` Đ u iEPuul QESEjPEj@PQQ$/EPuul ESEjPEj@PčEPuul SSEj PEj@Pu|랍EPuul SSEj PEj@PEP̃U8EV0Ήu)btPPh w^u Sf ffMup]S EZWM|5d EPjS֋=h EPjS׃}u\E܉E;E}Eȍu PEPM;ME}uh q MEEE몍EPjS֍EPjS׋E܉E;E}EEE9EL}uFEȍu PEPnM;ME}uh$q MEEE;E~E9E}}uh(q M[EEEj}uEu؋HTEMMu_MV`_[ZD$-tHu |$ v|$ wjt$l 3Sjh8uYYt:WVt$j0#FTjhpS5 h j#^_3[D$j0m3D$HT,3D$HT3D$HT3D$HT蝇3UfE Vf= tf= t f= tMMIuQMIQMIQMQNTP*P0!^^]UQQSVu ]W}E EEEEEEEPEPEPEPE PEHTG} t} t } tEfU EMffU@ffEAE_fEfM^f3[U0S]VW}uEEQEEEE EE$EFTب($E QM$G"NTEPEP\EE0,EP',PMENTPEPEPEPEPEP萜u t t tEEMf7fuUf3u@ABfE _^fE$[f3 l$ l$$l$(l$l$@l$,l$0l$0{l$0_l$4l$D$VW|$@ȋd 03_^l$Vt$FNPtNd^%@l$8Fl$8l$8|_l$둃l$D$@`Ѓl$< l$<l$D$tV Y^D$t$NMVt$Wt$R|Nh\h_^D$t$MVt$Wt$|Nh\mh_^D$jL~Vt$ t$ 6,F0 f4 F F0h ^VD$tVY^ A A0h VF F tjjP v f3Ft fPQh 8Z , ^UU V3;w.t#+tJu uPD^]uP@P8ʁthtQRt ItItIuË3뺋P0@묋P,uP(uW덃냋uPYYt-uu uhr PփPWYYu3_^jXU EVP3h?Vu u ;t3^VVVEVPEPVu ;uPuY;Yuu u u 3;UQQV} Wr }fu3_^u uH EP ;u s EPu@ USVPuYYttPhr P  EPEPjhjhw jPh u*EPh?jhr u u5 օt3^[ujXUu hr P  E Ph?jPu t3u  jXVt$V D0;r 8.tH@^3^VWt$ $ |$i ™V $ i ™G_^UlVj^hP5 L t[EPP_tGEPuOt7} tEMf;u3^$@ME;Mu ;Eu3;Mu9EFUSVW} j 3Y3E]P]u]YYt_VS5`  ؅t^SVuuEt4EPEPhr S EtMu} ȃtSj5` Đ E_^[V V4 = u6P- uhr < P- ths P(  u3^VD t$ t$  ^V V4 = u6P- uh s < P- th,s P(  u3^VD t$t$t$t$ ^V V4 = u6P- uh@s < P- thLs P(  u3^VD t$t$t$t$ ^UEVWtTutMf&URu PQ|0EURPQ |EPfH6fMQRLEPQ_^]ø@V=D$tVY^US]VWC3d f@Jf;u E 8x3u P ;u _^[]K;߉F d } QLv3ɋ4E M ;˥sUVu W}'9wtE+r/v;3_^]ÃNt0t(vv1vՁ8vuju tu uV jXUE VuW}t HHuEjV t8j_^]jV tjQQjj| EPWuu V tEWuu Vl jXjX D$L$PQ3l$D$t$ @t$ P l$D$H@Pl$D$H@Pl$ 븃l$ ̓l$ ۃl$$룃l$$븃l$$ƃl$(뎃l$(룃l$(뱃l$,vl$,닃l$,뙃l$0^l$0pl$0{l$4@l$4Rl$4]l$8"l$84l$8?l$<l$<l$Cxte9Kht0sX}॥ECPECTEECtuC<URPQ8Cxu C4tPQ E %@3Ch;tjsTsPQQQP 뵋P4문kD$tD$t$ PPY3Y kD$Vxpppu V |t$6t$VP ^ D$t$@pPQD$@puD$ @t$PQ|$uD$L$ @܋d @43 k3@UVuW} r!wFptF0t3҃RPQ uFNuWPLM_^3]@Vt$WFt$NPht3_^F,t8 Pt$v,WjX3D$@lt|$t @4jPQ333US] V #WV4 }M QG  d QfHf@QP5d ( VED E|'WE Sd 2PQE PQ} _^[]3jX3Axt39T$RPQ43UEVupu | uu VP@^] UVW}u w|)uu VPD|}tgd\tWP3_^]@Vt$t$ N||$tf`vXtVP3^ D$PQUE U Rjjjh PQ|EVu PQE PQ^]UE U Rjjhh PQ |7WVuu NXN\3 F\E PQ^_] L$A\t$A\ITtQP33Vt$| t$VP<^USVWjdu[j2e_u MM]Qh\s V}fEP | u EeMEQhps VP }E_^3[EEEPEPpYYUEVPQEuYEYMfEQhs VP|EMEQhs VP^USVujMjQVE!C4EP| EÈPSYYjMjQVP^[jXU8E eeeSVHWttt k_^[,] jSܓ u}EuuYEEEt8u @Eu$E}ȍpH3uEUȃuu(RSu PQH9u$tH}uBVuuS VuuS VuuS VuuS u S }t uȓ }Ȁ}kEjPS E3PVVS EPVVS EPS EPS jS E |$tkD$Vt$ HVt$ &Plt 39^ָ@@@D$SVjZtD$t$ tNt ttL$tFptPQ^3[D$t$t$ PQH3UEURu H@P|u k VuEVPYYEVPY3Y^؋D$3ɋ@̋d f9HWj5` Đ _^[~Vϋ؋AKt33ҋD$L$tPQ L$D$IHtPQ SV5P Wj3jf3jf3fCG_^[ËD$S\$VWf@jPYCY_^[ U(SV WV4 =8.  u@j 3Y} EEEP]` fuVD 3_^[8. VD 3ɋEQ5 Qu p0Euu% DPQSQp U(SV WS4 3954. u_j 3Y} ;ƉEuEܸ, Es EEP` ft$V5 VVVVVVhVhs Vp 4. SD 4. _^[UQEPuuu utEuuu ul VVt$ 踩D$ f(F 3F FFF,F$ F ^D$t$ @t$ P D$H@PD$H@PVD$tV|Y^UQE USV 9 WMujY 3t9 u0jY 3u uF#VPE 03_^[u MR\Vt$Ft fPQD$ FtPQ3^Vt$W~W|9|.Fut$v Nt$VP$jvX 3_^UQeEVuPjNhgv E|Ft P ff3^US]VWKu jY3jC d f@PFC Yd Yjf@PFC Yd Yjp 'Y3Y9~K F d I$Nt69~t1;t-[;tEPS E+EFE+EF 3_^[FȒ ;tPӉ~F;tPӉ~F;tPӉ~USVuWFtVP,NMj} 3;u 3_^[] PS5`  ;ÉFu؅vENtPQC;r3~FtM뤋D$@tt$PX 3D$Vpt*D$ WjHx @++WPQRjV 3_^D$@ЃUQeVuFtDMQjheP E|&Ft$Fvt ujVP 3^USVW}3ۋG ]d p K;YEu  t|VTSSV|ju SS |xP< 5@ xhs P֋G d p xP֋$ hs uӅu\G d p$xjPwydE|tEt|j5` Đ E_^%[@hs uӅuxhs P֋G d p$xjPwL SUVW|$3ۋG;ubW tuS l$u39Et,5 jjhP֨tw wh7֋Ct 3_^][EjX;t$ -P jf7v< jjhv fKSu,Pv tU@ tjUj(v jP 3fAAQ7v tFtWPQCu4/uUv< u jv WvH ؉/3j3fQjvD tjPj(v UVWjjhu uJE ;Et PE  u5 u ֋tjW %=t uWjX_^]3UQEE@PEu hfp ESVW~F jd @PP t`PP tMP ؅t@ W4 jh55 .PS5 8 % WD ~u5 օt% _^[3QVWF(tFtL$QjhgP F,t53vF$tPQG;~,rv$j5` Đ f$f,_^YVt$jV u3^u5 jV  pt$t$t$VRˋD$P Vq,W|$ ;sI$:u@;r3_^PUQeEVPjhdv F(t$F(vtjVP E^ÃI(A(It ujQP f=P VWu _^á8- u W4 f=P% uFth PQfP% WD jËD$t$ @t$ P D$H@PD$H@PVuD$tVY^USًV؍sW#PjWx u{E C(Ec0c8C,EC4EC<_@ CX ^[]VF8@ FX tHPQh 8Z , ^ËF4tPj5` Đ SVt$ W{;u j3Yt;hZ u2t$jYhZ 3u PL$Ã#É3_^[@UQSVuWe]~~~ } v%F;F}vWSV(FFEE;E rۋEMt;M _^[D$T$HʋP;~ jPXH3D$`3S\$ VW5` 3;j@t$Y;Ytv(Nv vvQ-u _^[FVG8FG0P3;5|Ū%@|謪%@U$MMSVW339=w }}}}tghP5 L WPYEYMQPX ;qEURPQEPHMHMMQR0f=` E` d 98;9}u+hPYEYht P@ E@(;tE= Pׅ~6p(@Pp(EP P 3E;E+$HHHEEf8%9=w tI;tjPY;YEu w PuuL ;ߋt uȒ EPQ;|3u _^[ÀXjE_P0u |} Wp fH@Qp405d uupppph0 43p 05d uuppph0 =$p 0ppUS3f=` VW]]tJ` Ed 0 E;t + JJJ Ef?u9d phP5 L pP ttVVptjPSS EPjtD ;|0EURPQ;|EpfHpf@QP5d H 9ttEttS5` Đ 9]t EuPQ0E;t ]PQ_^3[QppVSQYYV V4 =$ uV$ $ VD $ ^L$AA3V V4 =$ u$ $ VD =$ u ^ L$%jÍB[3D$ST$t B8t܄tQu WV ؋ ~333ƃu%t%uu^_[3ËB8t6t8t't8tt8tu^_B[ÍB^_[ÍB^_[ÍB^_[áw t u=% uD$P,hw VWt$ Pet F9=1 ~,jPuD FFu_^2 3fJD$Au3ËD$ |$Pt"L$QD$ L$T$J ÍL$QL$T$ À= SVWU= l$t$-Ņ3QP船̓?-uME-~QʊD = ֋ȕ ȕ f@fB= ȃ|$ tEAG 80t@_Ky-Ad|dÙÙA | ÙÙY]_^[ËD$HQR#t$$FWP-l$ ؅3Ps D$L$ T$PD$Q RP ËD$jjPT ËD$-w3ɊA$A3øøøøAAAAAW3(2 @󫪣83 83 _,3 03 AAËD$% áw t u.=% u%hx thÁ3ɸ x S$VWU9t A=x r9 x =w _=w u =% Ix$hP-L jՅu $f$$+уt FJu>u+_^á tL$QЃt3VצD$tVgY^D$ T$SV 9hZ WujYhZ 3t9H u(jYH 3ut$VPD$03_^[ @D$@H@HD$HH@HD$t$Ht$t$P0|$?VuF8tPj5` Đ f8^A,L$3A,L$3U4SVj3[jEEEEXF,E]Ex EEEx tv8hV ^[ F,W=P P׋N,S# ȉN,׋N,5`   j4N,3Y;YPVv$s9E9]t35` j8gY;YtzPVuv3E9]ua]Et HPQEtPQEtPQt.KCPQf,_ ]l]5` j8Y;YGPVuv Su{-؅F,t0<uEPSECEEPEPEPvy C(x } F,u 5` }j G YYt#VE}u]5eEPuuWВ  u1EPEPv uEtM3J@UQQVWF8uvN0tу:t@u@@Pj5`  F8tCV0e҉Ut+3 t#r  EtL }u׋M I$_^Ã|$Vu3^Ët$3t2֋ t*;L$ t@ @L$tfpVpQR ^ø^ËL$` HL$ HL$@H VD$tVY^ ËD$@@Vt$Nu t jPF^D$ T$SV ;P WujP Y3t;hZ u(jhZ Y3ut$VPD$03_^[ @UESVu]EFW3@^ ;tHPQFx5` j8Y;Yt.vNvWq u W5*N;ljAu_^[3A,f%<@EE]PS]EEx } }}YEYPSYEYNPEPqFH;tLMM }QMQMQMQMQMWQMQp$EN!%=}뵋At9t UWRPdNEWPSuq}US]VuWN} E~ A,f%<@ee EE]PW]EEx EYE YPWYEYNPEPqFHtKMMQMQMQM QMQMSQMQp$EN!_^%[e뵋At t UjRPJNEjPWSqU(VuWjN3X}]EEEEx 9yt~Q,f@u~EPv YEYPv FYYH;tSMMQMQMQMQMQMQMQMQp$F@;tHPQFx_3^}PEPEWP}}qUVuNA,f%<@eeEE]PEuEy ]YEYPuYEYNPEPqFHtZMMQMQMQMQMuQMQp NAtHPQNa^%e릋At t UjRP[NEjPuuq뒋L$ H@VD$tVcY^ ËD$@@Vt$Nu t jPF^D$ T$SV ;` Wuj` Y3t;hZ u(jhZ Y3ut$VPD$03_^[ @|$VWt _^ D$ T$HA,tt tu $A,Ʌuu $ ЉQ,3UVuEENEEx A,t0<uEPu |+EPE PEPFpNt ^E%y@~$At;|$ tBu4ЍЅt%|;t@ɋIf@RP1h| V03UQQESVWq3}}9>8usIURh[ AP;|EURPQ;| E;u.@E;t }PQE;t }PQ_^[Vh([ P;|ƋPQM3ۉ볃yVquAHVh P|PQL$3^UQAet t6uHtttURPQ 39EË@tEPsU VWFt EP>EURjPQ(EPQEPEP7YEYPEP7FYYuHtt+tsURPQ |_EjPju EP uE9u|9E M;M|;M~'+ƙ+‹ȋE+E+EMPQET _^Ë@t늍EP|rEPu 돋D$ D$tD$tD$ tËD$jY L$tD$tD$tU$SVu3;WM]t ^}t 9;ËuOt;tm;uGtURPQ ;E @EEPMu MEPj;EURjPQ(EPQ;uEPEP*YYMAt9t E)EE)E;t3EP\;|TEjUVRPQE;t ]PQ;|.t9tEPEPv5E YYMMH_^[ EPp;|E @EEPMu 5USVuW3;}E ; 8S>4 EMQ  d QfHf@QP5d ( SED E;EURuPQ;ljEEURPQ ;ljE]E;~H.;| @.EؐE P ;ljFP M ;ljA;߉}EURuPQ;ljEEWWUWRU2PQ0u \pS$}WWSpjuWW Ep@pht P ]jPYYNEM @I@u EuPQTF9<9ptEtpW5` Đ C;]]9}t EuPQLE;t }PQE;t }PQ3_^[Ë;t,9~t%3;~F;tPȒ C;|vȒ >u 9>tF;tPȒ >9}t EuPQLE;t }PQE;t }PQEy9ptEtpW5` Đ N5` j@萶YYt%hX`t$ jt$hp H#3t$t$YY Vt$ W|$ fvfGFGF G FYG_^Vt$u3^6 tWыʃ_^US39] VWuE w u}u3;u\>_^[]SFSPWju SS hy jjj0h< h0 USVW W4 E 390u?u< ;t>9uuv#u6S( Nt!EE;ErE WD 3_^[]ÅtSȐ WD ED$tt øø@Ã=8 ubWVj 5ܓ jWjhW4 j W ֣ 39 j8 (  Wj,  ^_U\SV W3V]4 98 umVD 9]5( EPju9( t=9] u, E 9= u#EMuEPju 9}v]U܋EUfUMЃEэEE(PMfE]U]]]ĉ]CY54 MED(PjB;ÉEt-= P9]Et&EPS;ÉEuu 3_^[Pj uYSE 9( tju W$ WE  EMD(39]EQuPuSuW 9( utju W$ E WS 9];tsu}j YuEVF EE<39]YD0(vMUE LJ( G;}r(VuSu  39]vNFG;}ruu u u ;uuEQSUV3WS3\$  V4 98 uVD 9( t$t!VY;tSUW$ WD$ VQYSVPjVW, 9( t(9\$tSt$W$ W ;u ;tU̓ D$WS( _^][YUE SVWtKuP6YYtKEPW P YYW W t$M E3_^[]Ëu6YtjXUSVEWPju( tuuuVjB4 ؅u3_^[S WVu4 u3S S EWPEPuu0 Vt$V> Yu@^^USV WV4 39=8 u4VD ];t=S;YEjY;@E PW5`  ;u3_^[ËMeEf~f~MXP]3ۊME 3҉]p  s&]3;…t]]uD ]]et҃}EHgHOOfF} M]39}uj}}tUp f~; }AMj[]u% ] Gf~L3ɍJH H`E}uV Vj5` Đ e?_=L$9 tA u'AHttt 3A jXjXUSV WV4  3;tVD _^[VD hW5`  ;u3WfFf} EFEF}E^~u U3Ɋ̈  Mj!EYMMPu 3Ɉj ME EXEEE}ruj EeEDEE3EEE 3ɃE] X X`ArGrE}rU;sD+ʀH ``Iu뿐 W4 V W D Vj5` Đ rS\$ VW =y (y tL W4 =y t03ɋffuf | fjYft tۃ%y WD 3ҋfft f;L$tB j_^[É3UVuEPVcYYjZ|&E@ ,y E `H f0PH3^]ËUEPu YY| EURPQUS] VuWuf }f? uLGU Rh P|7uuVSu +E PQ}_^[]Wu< 3Ã|~N~ ~Dt?fufEPfPiYY|,E@f0y PjWup =u5uhf? tuhu iWu@ ądPUUtQM tJ}tDf}tff;Etf}u;| uA;Et]ff+Ef%]øW]Vt$W|$ jjjVt$ W|&w D@Ph 4 Fu_^ÃfVt$W1 }v f3U S]VWh j}^VjSu WE|-}t(EPVWd |E PVWh E}6_^[ÃeE +E@;ƉEwPh 4 Cu ʋE ԃcP3 }tcEPu4 E|&Muuȃ8 s }}CtP s cEM'SVt$WjjjVt$$t$$|v0 ؃} p_^[v uWD$SpW2d v 3UEVfu e W}f7t U RPQf} uuh|u DE HtHHt#HHu ƅttuhf3ƅtth}Y_^]fƅtt΃~ fUQESVU@WRh P3;|#uuEuPfPu;ljE} _^[ËE};t URPQf9}uE@E;tPQEȋ]Ff{EHPHtEHHfEU RPQ ;ljEWu D ;Efudjh 4 t*EU RPQ ju @ E W 3밋u ;uREU}} RPQ ;ljE} EEU RPQ9} t$u u;ljE>CWWu#  E UF ERPQEURPQEWFEF {3HH4tjHKu F;t~sEURPQ ;ljE!EU RPQ9} t u u ;ljEF)3"EURPQ ;EU RPQ;ljEu uAY;Y3SVW|$W \$t$#>t _^[v uWjPfYGYv uVĒ 3USVW} W E]j ^93t _^[s EuWs0 EEEuPVjt Eu*E}t u| }t s E딍MQP4 E|ˋMtu}jȃ} ^u8 Esef G eSĒ E0tU|F;tPU5` Đ D$[.nn_U(eS VEWPӋE uf8 u39Hu)f> 9Nuwhw _^[f> u]~uT3fun5 frsfwlEj PP uUwhwQ ؍EP 떍EPjjEVPp ؅|׋uE fu5| 뉋E f8 u,xu#uf}u@f8 u xt1wj$wMwQMQVP4؃iE utfFPE FPuYY/fEfE f8 u xtEPu< ؅} t wht{؅4@wFPE E_3VW~If>f;|$ t@0;|3_^@D$f P |3VWG;~jX_^ËOu#j^hQ5`  Gu'ӍpvPQj5`  t܉Gw3UVW؍~#PujYM EN$M0 F u  ș F F(N,tPQF$tPQF,t HPQE_F0EF4^]VD$tVԕY^V Fș F F,t HPQw^VF(t PQf(F$t PQf$^USVuM W!;$ uj$ Y3ty; u/ujY 3up$up(VPE 03_^[];$ u!ujY$ 3u@,tp3;( uujY( 3u #;Z uujYZ 3u u u xVt$W~ up~~u`5` j4$YYt&vv5@w  Fu_^3v }NtjfҋvtFL$NFPQ33vhv U$S] VW3f}u1 u u9~ t)vhvl _^[ fu΋| 9~EPSGY;Y|fuvj빋FURPQ;t vh랋FURU܋RPQ |]jY;M~a~ ~W ~tuHj Y%E PEuvuPZ} te}t EPĒ ;| tE PEuP 뽍E PEuPvhvE vT$fu* D$H t( R&؋L$ f3 fuՋ| ͋HtRQ6YY3ɅD$ Ifphp Vt$~ t$FtHPQ(| N ^v~hv D$H tD$ PD$Pc$pxhpG S\$VW|$WSN  D$` F4D$F,PF0^~QF,PQ(f$f(_^[VF,` PQN$N 6^UVu WjYhZ 3t"u jY 3tE @_^] uVPE03D$@0@0Vt$N0F0utjVtY3^UQS]VW:} 03uMQu VP0t|d_^[ uN u΋|f OMuAu8F,URPQ |U f:u}Cvhv 됋U  2}tt~~h;| SRQt͋MSRQ1뾋t@Otu͸@7E Pv,YY!M cK v$vSRVQWUSVWu3EN fE @fE@EEE}Rf{ {f;uF,URPQ 9}VYEu0tWPMtEPQ_^[xWP; uVEF4URhZ P|EuWPQEPQE}PEPEPv43k;| EtE3tUS] VW}3uM QSVP0t|d_^[] u N {tiu d|f Ouu@Ht@uSQ 뛸WUEURu PQ0]D$ SVW|$3;u W_^[  thGukD$9X p ~SLff;t C;|jXS2@(Gt D$3렸i뙋D$VWt)T$t!xjYu 0_^ b3W@UQQSVW3} }t @_^[ u;uW ` >;ωMteEX @ PWQ ;ljEtF9;} ~-Eu h}EjE E Y;|ۋu3u3Y;Yu9}t uWuĐ [3T@Vt$W5` ~,j8-YYtvvW5FxNtPt*Tt$FxNtPEP5PFlH"^3؋F|VFlx t:FxNtP蟜t%TtFxNtP?PFlH \x^3݋F|D$VfL$ fNxL$N|Ftȃ#ȉNdlf^ U SVW39~Dt+FXNTP;tT;tWWWP_^[3FL;te U;u_F\P;ljEtNTPFXPYEPrYNTjN;ljEtN\P]N3뚋H;tA ;u>F\NTPFXP< NTjzN\PN;3뾋H; ;F\ǃ ؋ۍP#ڊYQ@A FXNTP!NTEjPN\ύx#׊QQ@ANn3y@ ;tE ;F\NTPFXP$NTj N\PNV3뺋D$t$PQ$D$t$PQ(SVW|$\$wf_uGOPt SPYYVO芸_^[UVW}wf_uRGOPu u  t4eEPu AYYuGuOP"EPApYVO _^]Vt$~tZFNP(t5Tt/FNPPjt$NjPN贷^3͋F Ը_Vt$~tZFNP輘t5Tt/FNPPjt$Nj葹PNH^3͋F Ը_UeVu~t^FNPGt9Tt3FNPEPPju Nj蠹PNж^3ɋF Ը_Vt$~tZFNPחt5Tt/FNPwPjt$NjOPNc^3͋F Ը_VW|$ wf_uGOPRqL$VO_^VW|$ wf_uGt$OPyVO۵_^UQVW}wf_uEOPEPGPE fMfVO葵_^UQVW}wf_u*EOPEPGPE uOPGPVO;_^UQVW}wf_uEOPEPGP<E fMfVO_^UQVW}wf_u*EOPEPGPE OPGuP^VO蚴_^VW|$ wf_uGOPL$VO^_^VW|$ wf_uGt$OPQVO%_^SVW|$\$wf_uGOP@t SP=YYVOӳ_^[UQQVW}wf_uYGOPxu u  t95` hpYYt2ɹEe}u$LEPkYVOM_^eҍEPu ;u;F\NTPFXPNTjmN\PnfN3@ ;tA ;uF\NTPFXPNTjEN\P,vN']3뾋WWWPJSVt$ W39~u2_FpL$WN_^[Ft HPQ5` hNYYtDv fNV^Qv#Q#֋RvjdNnLd33qVt$Ff%_u?FNPrt5Pt/FNPڒPjt$NjƑPN^3͋F |Vt$Ff%_u?FNPrt5Pt/FNP/kPjt$NjPN裐^3͋F Vt$Ff%_u?FNPqt5Pt/FNP;Pjt$NjPN2^3͋F VW|$ wf_uGOP[D$VO_^VW|$ wf_uD$GQO$PVO譏_^SVt$ W~f_u FNPv fF^PvWc_^[VW|$ wf_uGjjOPG\ jVO_^l$t$t$] VD$tVSHY^l$TD$t$ @t$ P l$TD$H@Pl$TD$H@Pl$pt$t$[]l$pt$t$t$t$聤l$pUuuuuu uL]l$pUu(u$u uuuuu u裣]$USVWju~pu^ #j(h& #PQPuu Ntj {f|~l FХ  p Ftl t uD_^[]VٍFt FХ #F Fpp l :^ËD$VЉA|ڍp#։AxQd^Vt$39Ft!NqLNPt$P=PN^_Vt$W~u"_FNjjjPWN܌_^t$NÕut$ N @PQVt$~t$FN4Pjt$jlPN而^_L$Af%_uQ Vt$ RY^l$TD$t$ @t$ P l$TD$H@Pl$TD$H@Pl$pt$t$GSl$pt$t$t$t$ml$pUuuuuu u8}]l$pUu(u$u uuuuu u菙]$USVWju~pu^ #j%h0& #PQPuu u ftH F8 (  )_^[]H A8 A ( Ap D$AtAdVW|$ wf_uOL$fVO:_^VW|$ wf_uD$OP<VO_^L$Af%_uQVt$ f^P΂VW|$ wf_uD$OPVO蚂_^L$Af%_uQVt$ f^PdVW|$ wf_uD$OPfVO0_^L$Af%_uQVt$ f^PVW|$ wf_uD$OPVOƁ_^l$t$t$P VD$tV:Y^l$TD$t$ @t$ P l$TD$H@Pl$TD$H@Pl$pt$t$Pl$pt$t$t$t$)l$pUuuuuu uy]l$pUu(u$u uuuuu uK]$UESVWtsHQu~tu^ #j"h& #PQPu u|P fx~l F   t u_^[]3 A A At QSU\$Vd$ WFl8t'HPQ39D$u Nl<9;tGp_^][Y5` jxVO{_^Vt$39Ft%N$QPt$NPPNT{^_L$Af%_uQVt$ Df^P{VW|$ wf_uD$OPVOz_^Vt$~t&FNPjt$jPNz^_SVt$ W39~u3_F@pL$WNlz_^[F@t HPQ5` jxh7YYt=Vvʍ^#Q#֋RvjNAvLl33zSVt$ W39~u3_F@pL$WNy_^[F@t HPQ5` jx6YYt=Vvʍ^#Q#֋RvjNAvLl33zSVt$ W39~u3_F@pL$WNy_^[F@t HPQ5` jx6YYt=Vvʍ^#Q#֋RvjNAvLl33zSVt$ W39~u3_F@tL$WNVx_^[F@t HPQ5` hO5YYt=Vvʍ^#Q#֋Rvj>NAsLi33wVt$Ff%_ut$ FzYYPNw^US]Vsf_u@eEPu YYuW{uϋPTKW_EPs/YVK?w^[]VW|$ wf_u3OPPPG\ j薷VOv_^UMVAf%_uU t6Jt(JJtMPv^] Q ufQQUVW}wf_uE t9Ht'HHtMVO^v_^] EOPEOPqEOPBċL$Af%_uQVt$ T4t$^Pu l$t$t$D VD$tV0/Y^l$TD$t$ @t$ P l$TD$H@Pl$TD$H@Pl$pt$t$8Dl$pt$t$t$t$^l$pUuuuuu u)n]l$pUu(u$u uuuuu u耊]$USVWju~pu^ #j h$ #PQPuu s8 ft~l F   t u)_^[] A A Ap 騴D$AtAdVt$39Ft"NQPt$NPuPN-t^_Vt$~t$FNPjt$juPNs^_l$t$t$B VHD$tV&-Y^l$TD$t$ @t$ P l$TD$H@Pl$TD$H@Pl$pt$t$.Bl$pt$t$t$t$Tl$pUuuuuu ul]l$pUu(u$u uuuuu uv]$USVWju~pu^ #jh ' #PQPuu qu ft F  ` )_^[] A A Ap` 餲D$AtЃ#ЉQdD$xtHT$I8f xt3h_HrVt$~tD$ NP7~t3^h_NqD$xtHT$I@ xt3h_HqVt$~t't$ FFp4C ~t3^h_NtqD$xtHT$Ipf xt3h_HCqVt$~tD$ NP6~t3^h_NqD$xtHT$ID xt3h_HpVt$~tt$ Ns~t3^h_Npl$t$t$? V D$tV)Y^l$TD$t$ @t$ P l$TD$H@Pl$TD$H@Pl$pt$t$>l$pt$t$t$t$l$pUuuuuu uh]l$pUu(u$u uuuuu u5]$USVWju~pu^ #jh' #PQPuu nuЬ ft F x 8 )_^[] A A x Ap8 cD$AtЃ#ЉQdD$3S9Ht P39T$ f9Ht3[h_HnVt$~tN3f9D$ P4~t3^h_NnUQQVu~tBF݀]t u E% ]EE ~t3^h_N5nUQQVu~tEFE ]t> u E % ]EQQN$83~t3^ h_NmD$3V9Pt*H;tt$ I4RHm^N_D$xtL$fxt3h_HhmD$xtHT$f xt3h_H4mVt$~tD$ NP2~t3^h_Nml$t$t$; VD$tV8&Y^l$TD$t$ @t$ P l$TD$H@Pl$TD$H@Pl$pt$t$@;l$pt$t$t$t$fl$pUuuuuu u1e]l$pUu(u$u uuuuu u舁]$USVWju~pu^ #jh0' #PQPuu ku ftx Fh X  )_^[]x Ah A X Ap 鶫D$AtЃ#ЉQdD$3S9HtP39JHT$ f9Ht3[h_H$kVt$~tN3f9D$ PSu~t3^h_NjD$xtHAPL$xt3h_HjVt$~tD$ QQN$~t3^ h_NjD$xtHAXL$xt3h_HTjVt$~tD$ QQN$~t3^ h_NjD$xtHT$I`f xt3h_HiVt$~tD$ NPX~t3^h_NiD$xtHT$Idf xt3h_HiVt$~tD$ NP$~t3^h_NSil$t$t$'8 VD$tV"Y^l$TD$t$ @t$ P l$TD$H@Pl$TD$H@Pl$pt$t$7l$pt$t$t$t$~l$pUuuuuu ua]l$pUu(u$u uuuuu u}]$USVWju~pu^ #jh' #PQPuu Ugu ftH F8 (  )_^[]H A8 A ( Ap  D$AtЃ#ЉQdD$xtHفL$xt3h_H|gVt$~tND$ P.~t3^h_NIgD$xtHT$ xt3h_HgVt$~tND$ Pcq~t3^h_Nfl$t$t$5 VD$tV Y^l$TD$t$ @t$ P l$TD$H@Pl$TD$H@Pl$pt$t$#5l$pt$t$t$t$I|l$pUuuuuu u_]l$pUu(u$u uuuuu uk{]$USVWju~pu^ #jh& #PQPuu d0 ft~l F خ  t u)_^[] A A خ Ap 铥D$AtЃ#ЉQdVt$~t&NXPjt$NjoiPN e^_Vt$~t&N;Pjt$Nj7iPNd^_l$t$t$3 V8D$tVY^l$TD$t$ @t$ P l$TD$H@Pl$TD$H@Pl$pt$t$ 3l$pt$t$t$t$/zl$pUuuuuu u\]l$pUu(u$u uuuuu uQy]$4ttÍUSVWju~pu^ #jh& #PQPuu bu ft F  X )_^[] A A ApX _D$AtЃ#ЉQdD$3S9HtP39JHT$ f9Ht3[h_HbVt$~tN3f9D$ Pl~t3^h_NbD$xtHT$Ihf xt3h_HcbVt$~tD$ NP~t3^h_N/bD$xtHT$Ilf xt3h_HaVt$~tD$ NP&~t3^h_NaD$xtHT$f xt3h_HaVt$~tD$ NP'~t3^h_Nbal$t$t$60 VD$tVY^l$TD$t$ @t$ P l$TD$H@Pl$TD$H@Pl$pt$t$/l$pt$t$t$t$vl$pUuuuuu uY]l$pUu(u$u uuuuu uu]$USVWj u~pu^ #jh@' #PQPuu d_а ft~l F x 0 t u)_^[] A A x Ap0 D$AtP #‰ADP8Vt$39Ft%NQPt$NPcPN_^_VW|$ wf_uGOLL$fVO<__^SVt$ W39~u3_F@pL$WN^_^[F@t HPQ5` jxYYt=Vvʍ^#Q#֋RvjNAvLl33zSVt$ W39~u3_F@ pL$WNJ^_^[F@ t HPQ5` jxFYYt=Vvʍ^#Q#֋RvjNA vLl33zSVt$ W39~u3_F@pL$WN]_^[F@t HPQ5` jxYYt=Vvʍ^#Q#֋RvjNAvLl33zSVt$ W39~u3_F@pL$WN\_^[F@t HPQ5` jxYYt=Vvʍ^#Q#֋Rvj ft~l F  H t u)_^[] A A ApH D$AtAdUSV~du _^[]EURhHx P}uvtPYYu F N SSSPEPQVt$39Ft't$ NPA~YYt PN>^h_USVuW339~tSE}Pu Y;YuFuPFYYNWWWPEP}9~YtSND>_^[]h_D$xtHA L$xt3h_H>Vt$W39~t.ND$Y tD$WA FNWWP9~t3_^h_N=D$xtHT$fIf xt3h_H=Vt$W39~t(L$F9HtHFNWWWP9~t3_^h_NH=D$xtHT$fIf xt3h_H=Vt$W39~t(L$F9HtHFNWWWP9~t3_^h_N<Vt$39Ft"NQPt$NP=PN<^_l$t$t$q  VD$tVY^l$TD$t$ @t$ P l$TD$H@Pl$TD$H@Pl$pt$t$ l$pt$t$t$t$Rl$pUuuuuu u4]l$pUu(u$u uuuuu u%Q]$USVWju~pu^ #j h$ #PQPuu :u ftp F` P  )_^[]p A` A P Ap S{D$AtAdD$xtHAL$xt3h_H:Vt$W39~t.NA\$tD$WAFNWWP9~t3_^h_N:D$xtHAL$xt3h_HZ:Vt$W39~t.NA\$tD$WAFNWWP9~t3_^h_N:UVuW39~tANA] u A]tE WAFMWHFNWP9~t3_^] h_N9l$t$t$ V`D$tVY^l$TD$t$ @t$ P l$TD$H@Pl$TD$H@Pl$pt$t$l$pt$t$t$t$Ol$pUuuuuu u1]l$pUu(u$u uuuuu u9N]$USVWju~pu^ #j h0% #PQPuu 7h ft~l0 F  ظ t u)_^[]0 A A  Apظ axD$AtAdD$xtHT$I xt3h_H7Vt$W39~t'FL$9HtHFNWWWP9~t3_^h_N7Vt$39Ft"NQPt$NP8PNs7^_Vt$~t$FNPjt$jx8PN=7^_D$xtHT$I xt3h_H7Vt$W39~t+FL$P;tfHFNWWWP9~t3_^h_N6l$t$t$ V]D$tVY^l$TD$t$ @t$ P l$TD$H@Pl$TD$H@Pl$pt$t$l$pt$t$t$t$"Ll$pUuuuuu u.]l$pUu(u$u uuuuu uDK]$USVWju~pu^ #j h$ #PQPuu 4u8 ft F   )_^[] A A Ap ruD$AtAdD$xtHT$fIf xt3h_H4Vt$W39~t@FfL$fPf;u@t`HNW:FNWWWP9~t3_^h_N4D$xtHT$fIf xt3h_Ha4Vt$W39~t@FfL$fPf;u@t`HNWj:FNWWWP9~t3_^h_N4D$xtHT$fIf xt3h_H3Vt$W39~t@FfL$fPf;u@t`HNW9FNWWWP9~t3_^h_Nv3D$xtHT$If xt3h_H>3Vt$W39~t6NA$f;D$tD$PQ9FNWWWP9~t3_^h_N2UVuW39~tZNfAf;E ufAf;EufAf;EuAt#uuu ?NW8FNWWWP9~t3_^]h_Nt2l$t$t$H VD$tVY^l$TD$t$ @t$ P l$TD$H@Pl$TD$H@Pl$pt$t$l$pt$t$t$t$Gl$pUuuuuu u*]l$pUu(u$u uuuuu uF]$USVWju~pu^ #j hP% #PQPuu v0 ft~l F  x t u)_^[] A A Apx $qD$AtAdD$xtHT$I xt3h_H0Vt$W39~t'FL$9HtHFNWWWP9~t3_^h_Nb0Vt$39Ft"N QPt$NP0PN60^_l$t$t$ V D$tVeY^l$TD$t$ @t$ P l$TD$H@Pl$TD$H@Pl$pt$t$ml$pt$t$t$t$El$pUuuuuu u^(]l$pUu(u$u uuuuu uD]$USVWju~pu^ #jh`% #PQPuu /. ft~lx Fh X  t u)_^[]x Ah A X Ap nD$AtAdD$xtHT$I xt3h_H^.Vt$W39~t'FL$9HtHFNWWWP9~t3_^h_N.Vt$39Ft"NQPt$NP*/PN-^_Vt$~t$FNPjt$j.PN-^_D$xtHAL$xt3h_H-Vt$W39~t.NA\$tD$WAFNWWP9~t3_^h_N6-l$t$t$  V[D$tVnY^l$TD$t$ @t$ P l$TD$H@Pl$TD$H@Pl$pt$t$vl$pt$t$t$t$Bl$pUuuuuu ug%]l$pUu(u$u uuuuu uA]$USVWju~pu^ #jh@% #PQPuu 8+p ft~l8 F(   t u)_^[]8 A( A  Ap kD$AtAdD$xtHT$I xt3h_Hg+Vt$W39~t'FL$9HtHFNWWWP9~t3_^h_N$+Vt$39Ft"NQPt$NP+PN*^_Vt$~t$FN$Pjt$j,PN*^_l$t$t$ VD$tVY^l$TD$t$ @t$ P l$TD$H@Pl$TD$H@Pl$pt$t$l$pt$t$t$t$@l$pUuuuuu u"]l$pUu(u$u uuuuu uA?]$USVWju~pu^ #jhp% #PQPuu ( ft~l Fؼ ȼ  t u)_^[] Aؼ A ȼ Ap iiD$AtAdSVt$ W39~u2_FpL$WN(_^[Ft HPQ5` jxYYt@NV^Q#Q#֋RvjNNuLk33xSVt$ W39~u3_F@pL$WN*(_^[F@t HPQ5` jx&YYtANV8^Q#Q#֋RvjNArLh33vSVt$ W39~u3_F@pL$WNt'_^[F@t HPQ5` jxpYYtANVT^Q#Q#֋RvjNArLh33vl$t$t$ VD$tV3Y^l$TD$t$ @t$ P l$TD$H@Pl$TD$H@Pl$pt$t$;l$pt$t$t$t$a<l$pUuuuuu u,]l$pUu(u$u uuuuu u;]$USVWju~pu^ #jh% #PQPuu $u8 ft F  H )_^[] A A ApH eD$AtP #‰ADPIVt$~tNL$ f~t3^h_N%Vt$39Ft!D$ NP~t PN$^h_D$xtHT$IHf xt3h_H$Vt$39Ft!D$ NPA~t PN$^h_D$xtHT$ILf xt3h_HN$Vt$39Ft!D$ NP聦~t PN#$^h_Vt$~tNL$ f~t3^h_N#Vt$39Ft!D$ NP˨~t PN#^h_Vt$39Ft+T$NRT$JR~t PNy#^ h_Vt$39Ft+T$NRT$JR~t PN;#^ h_Vt$39Ft+T$NRT$JR~t PN"^ h_Vt$39Ft+T$NRT$JR~t PN"^ h_Vt$39Ft+T$NRT$JR~t PN"^ h_Vt$39Ft+T$NRT$JR~t PNC"^ h_Vt$39Ft+T$NRT$JR~t PN"^ h_Vt$39Ft+T$NRT$JR~t PN!^ h_Vt$39FtNjdP-V~t PN!^h_UVu39Ft3URNURURU R~tPNO!^]h_Vt$39FtN~t PN!^h_UVWM3Tu9~t%EHNPE HPgt MQRDuuEP #YY~tWN M_^h_UQVuW3!}9~t^9}t!u tEPuYYuEuHNPE HPרEPh~YtWN. _^h_UVWM3cu9~tEWNPE HPuuEP?"YY~tWNM9_^ h_UVWM3u9~tEWNPE HP3uuEP!YY~tWNhM_^ h_UVWM3u9~t%EHNPE HP腍t MQRDuuEP]!YY~tWNMW_^h_UQVuW3!}9~t^9}t!u tEPu4YYuEuHNPE HPEP~YtWNk_^h_Vt$39Ft+jdPD$NPD$HPx+~t PN+^ h_Vt$39Ft+jdPD$NPD$HP?.~t PN^ h_UVu39Ft=U RNURURURURU R~tPN^]h_UVu3W9Ft]ENPEHPE HP u,M}3҅JftURjPLuEM~tPN'_^h_UQSVuW339^]t~f9]tSEHNPE HPl 95` jY;YtCEfO G _;}u(LEP9^YtWN_^[3Wh_l$t$t$U VD$tVY^l$TD$t$ @t$ P l$TD$H@Pl$TD$H@Pl$pt$t$l$pt$t$t$t$1l$pUuuuuu u]l$pUu(u$u uuuuu u 1]$USVWju~pu^ #jh% #PQPuu ` ft~l( F  о t u)_^[]( A A  Apо 1[D$AtP #‰ADPVt$39Ft"N`QPt$NPPN^_Vt$~t$FN8Pjt$jPNn^_Vt$~t&FN8Pjt$j"PN6^_Vt$~t&FNPjt$jGPN^_UQeVuW~u_WN_^FNPEjPjuҋMu A#]EPQ뱋D$xuh_HuQQh H0D$H3;t PPPPjYl$t$t$ VD$tV{Y^l$TD$t$ @t$ P l$TD$H@Pl$TD$H@Pl$pt$t$l$pt$t$t$t$.l$pUuuuuu ut]l$pUu(u$u uuuuu u-]$USVWju~pu^ #jh% #PQPuu ENtjH  f|~l F   Ft t uD_^[]VٍFt F #F Fp  b W^ËD$VЉA|ڍp#։AxQd^Vt$39Ft"N 8QPt$NPPN7^_Vt$~t$F N`Pjt$j.PN^_SVt$ ~u_SN^[t$N؅ut$ 3;ȋN PaFNSSSPVt$~t&F NLPjt$j[PNo^_Vt$~t&F NhPjt$jPN7^_UQeVuW~u_WN _^F NhPEjPj,uҋMu A#EPQ뱋D$xuh_HQQh H,D$39HtQQQQHj Vl$t$t$O VD$tVY^l$TD$t$ @t$ P l$TD$H@Pl$TD$H@Pl$pt$t$l$pt$t$t$t$*l$pUuuuuu u ]l$pUu(u$u uuuuu u*]$tD$t$PQ4D$t$PQ8Vt$~tt$ NPN4^_Vt$~tt$ NaPN ^_USVWju~pu^ #jh% #PQPuu Ntj@ [f|~l F   Ft t uD_^[]VٍFt F #F Fp  S^ËD$VЉA|ڍp#։AxQd^Vt$~t$F N`Pjt$jPN^_SVt$ ~u_SN^[t$N؅ut$ 3;ȋN PNFNSSSPVt$39Ft"N 8QPt$NPPN_^_Vt$~t&F NLPjt$jPN'^_Vt$~t&F NhPjt$j8PN^_UQeVuW~u_WN_^F NhPEjPjuҋMu A#NEPQ뱋D$xuh_HfQQh H(D$39HtQQQQHjQl$t$t$ VD$tVkY^l$TD$t$ @t$ P l$TD$H@Pl$TD$H@Pl$pt$t$sl$pt$t$t$t$&l$pUuuuuu ud ]l$pUu(u$u uuuuu u%]$tD$t$PQ(D$t$PQ,Vt$~tt$ NPN^_Vt$~tt$ NPN^_USVWju~pu^ #jhP' #PQPuu  ft~lh FX H  t u)_^[]h AX A H Ap cOD$AtP #‰ADPydtbAlH0tXVW~dtKFx~pp&;~p}8SFl<t'NxW؅tFlS 腑FlS G;~p|[_^UV~DtFL@t, 9Eu NPFPjPQ\uuu u^]3ӋD$xtHT$` xt3h_H Vt$~tt$ NW~t3^h_N D$xtHT$4f xt3h_H Vt$~tD$ NP軈~t3^h_N D$xtHT$D xt3h_HS Vt$~tt$ N~t3^h_N! Vt$~t,F`ـ8Q$7D$YY~t3^h_N Vt$~t0FD$ `Q$|7YYQN$興~t3^h_N D$xtHT$< xt3h_H^ Vt$~tt$ Nq~t3^h_N, D$xtHف8L$xt3h_H Vt$~tD$ QN$I~t3^h_N D$xtHف<L$xt3h_H Vt$~tD$ QN$u~t3^h_NZ D$xtH3҃y@L$Jfxt3h_H" Vt$~t$fD$ Nf$PDQ~t3^h_N D$xtHف0L$xt3h_H Vt$~tD$ QN$H~t3^h_N{ D$xtHف4L$xt3h_HH Vt$~tD$ QN$d~t3^h_N SVt$ W39~u3_F@pL$WN _^[F@t HPQ5` jxYYtANVD^Q#Q#֋Rvj肔NArLh33vVt$39Ft"N`QPt$NP] PN0 ^_Vt$~tNjgL$ ~t3^h_NVt$~tt$ N4~t3^h_ND$xtHف@L$xt3h_HVt$~tD$ QN$迅~t3^h_NVSVt$ W39~u3_F@ pL$WN_^[F@ t HPQ5` jxYYt=Vvʍ^#Q#֋RvjζNA vLl33zSVt$ W39~u3_F@pL$WNg_^[F@t HPQ5` jxcYYt=Vvʍ^#Q#֋Rvj虳NAvLl33zSVt$ W39~u3_F@pL$WN_^[F@t HPQ5` jxYYt=Vvʍ^#Q#֋Rvj踭NAvLl33zSVt$ W39~u3_F@pL$WN_^[F@t HPQ5` jxYYt=Vvʍ^#Q#֋Rvj貯NAvLl33zUQeSVuW~u9E_}F@0tM uNF_^[F@0t HPQ5` j|AYYtD~V^Q#Q#֋RWj&NA0mELa33qD$xtHT$Pf xt3h_HVt$~tD$ NP1~t3^h_NaSVt$ W39~u3_F@4pL$WN$_^[F@4t HPQ5` jx YYtDNV^Q#Q#֋Rvj]eNA4oLe33sVt$~tNL$ ~t3^h_NtD$xtHT$0f xt3h_H@Vt$~tD$ NPn~t3^h_N UQeS] VuW~u:E_}FD pM uN_^[FD t HPQ5` jx詿YYtsVtaOtVOtKOt@3VWʍ~#Q#֋RvjND KEL?,뺋(벋$몋 3EM3$D$39HdtQQQQHhjjBl$t$t$ VyD$tVY^l$TD$t$ @t$ P l$TD$H@Pl$TD$H@Pl$pt$t$l$pt$t$t$t$@l$pUuuuuu u ]l$pUu(u$u uuuuu ub]$Ht jXUVWuu u }~ Fu E$f`FLE(FPEfdflFTEFXE },F\EFhp F` ~)PƾYFlt3~`~ Nl$@;F`|FLtPQNPt֍F #R_^](D$t`R` RP/D$SVWFl3ۋ8t)HPQu[Fl<8tQGpL$_^[5` jx豼YYt)t$vXvTvht$(Nl9uL33뮋D$SVWFl3ۋ8t)HPQu[Fl<8tQGpL$_^[5` jx*YYt)t$vXvTvht$(3Nl9uL33뮋D$SVWFl3ۋ8t)HPQu[Fl<8tQGpL$_^[5` jx裻YYt)t$vXvTvht$(Nl9uL33뮋D$SVWFl3ۋ8t)HPQu[Fl<8tQGpL$_^[5` jxYYt)t$vXvTvht$(9Nl9uL33뮋D$SVWFl3ۋ8t)HPQu[Fl<8tQGpL$_^[5` jx蕺YYt)t$vXvTvht$(rNl9uL33뮋D$SVWFl3ۋ8t)HPQu[Fl<8tQGpL$_^[5` jxYYt)t$vXvTvht$(WSt(R$Et.PWSEEPGYG;~|C;^|E_^[ELًQ Vt$ҋt+x;A}ЉI ^3Qt$ T$T$ R UURu]t$jQt$JRT$Vu RP`^q t+@x;A}2I ك"3ҋT$Vu RPd^q t+Hx;A}2I ك"3USVWM3:Ma9^]39~~TWutMQRD؅u+MEPf؅uFH;tMjhDt 跠G;~|uFH9EtMjhHt 蓠EE;FxtMM訖_^[UeSVW}Mu>QE;;;u x}7jYU;\ ;Q;Iu 9}2}ىMi?ʍ MMϋ]<у}}U u$}}|;rJVU i?ЍE+E@MM΋uEMMM};} F w8<tNPYGE]C;w@i?߉E닋MuQMQ}}~ 3 ʃMEMMEE MMpE_^[EMQ3;Wt(3;~"Vt$ Q 94u T$I2G;y|^_UQS] 3VWyE;u N_^[q U+x;}9u IEԸMVL$hh# t$^SVW|$Wxt0OvP$OvP$39^~F 4C;^|!_^[V5` jrYYtfN G ^^3^VWP<|$ PϋP5LV^kxۂʂVL$hP# t$^t$5` hhFYYtS3øxL 33UE u j @t@Ht2Ht$HtHt ]E ]E ]E  ]E  ]E]UE u j @t@Ht2Ht$HtHt ]E ]E  ]E  ]E  ]E]ËD$t#HtHt D$  D$ D$ËD$t#HtHt D$ $ D$ ( D$ËD$HtHHtHt3jXjXUQQEEEP YEPEP EE YYEP EYMUVWM3Ñd- uVPYYtE 8M輌_^ád- V P~YYt E ҡd- V8P^YYt E 벡d- VPP>YYt E 뒡d- VhPYYtE oMeSVt$ W΋Pt3~'Wشtppt$ t G;|3_^[ÃUQVEWPE3PuM tf< tbEPQYEYuGEPQ$%YYuQ$uu EYYu u"YPQ$f YY_^ËEuj @EUSVW}u=j GuEQ$YYWQ$]YHYHHt{Hd- tk]u WY؃} tESQ$ ]YYjESPuEu QQ$ivuu δ u c Y_^[]Í듡d- 놡d- vd- fV5` j YYt萎fH ^3^VWP<|$ PϋPItAIt.ItIIt ^_^pR\@肟F@u@@UVEWP3 jWuEPp |EF_^^jXUQQVEjPEMPE/ uu^VL$h/ t$^Vt$WNwPY tV_^SVW3=t2H \$5 t SP֋uS5 ֋uSP֋_^[39 t t$Pp QSUVW3|$ۍtXH  5 ;tMjt$P;t@P5H Ӌ=H D$l$ttHht$Wօt8PWӉED$_^][Yjt$5 ;tP5 Ӌ= D$묃eɡ. uPܒ 3Ʌ. f%VD$tVY^VN6D$tVY^PUSVWjX9Ct39Kt9Kt9Ku KK KC{C} u;~>ss P Cu*!CC CC;~PVR CC+;} CK+;~Ps R cCC Ctϋ{ȋE CCC_^[]u uP CVW|$ 3IGWP$NWt$_^VD$jNP^UEVEEjNP^]UEVEEjNP^]VD$jNPy^VD$jNPa^VD$jNPI^VD$jNP1^VD$jNP^VD$jNP^UQ}Vt6u ENEjPEtNPu^eVjt$ N^VW339y ~At;t A$GF;q |q|_^ËD$+D$UEVPu貄Pq^]A t$HP^D$V8u PR(^PPuHP3UURu]S\$ VW|$f#PjYt)00@PhjYt tJЅ}3_^[f3US] 3VuWUUUt-Ju: / u3}M@Uu˃}t3_^H[WiYtR}u$Љ} E  0 8 r,EM]@ E\Љ} E ԃMu-u@MEYUV339M t$9Mu uQP ^]uQP 9MtuQPĐ UhV3u e}3j*t t,EjePjuh@h@ EPY^uUQVW39=D uy3I_^ËqtG=D Etu 3ɅA3UVuWGG=D Et u tG@fF_^]3fUQVFt =D Et#u 3ɅANuz^3T$ t u@SVW|$33ۋt$IW6t$ u>_^[UQMSVu W}3ۉ] twPagYu/ :u} t8Gt 3ۉGE C: i t: i u ~&: i u ~: `/ t: \/ ut&eEt >t~&_^[Ê/ .tL$t <.tAUH E ZU MP v%X QQ$Zu YY]%\ QQ$@SUH E YU MQQP $v Zu YY]SUQSVuW3ۋMQP$}tuMQPM؋QP,_^[US]VW} ;t?t,t2MQP$}t&9]t9}tMQP,_^[]jX3D$j+D$ YIA#UQVMQP$}t9Et MQP,E^UQVMQP$}tPuRt MQP,ދE^UQVMWQ3P$}t;EuGMQP,_^t$PUVuWMQP$}tPR@MQP,_3^]SVW|$t$'NPt WPRH_^[UURu]AÊA@t ? 5P 蛏Vj' 'D$tP^3ɈFfNFAT$+u,AT$ +uAT$ +uAL$ +u3jXVW|$ OVRP,OVRP,OVRP,OVRP,f _^=. u|D$| $}x- 3SVW|$OfVRPf^FPVWYYPYYNSP_^[5` j(YYt35` j(YYt3øL VWP<|$ PϋP<ӡt W9_^ZVW|$ ϋPE+ƙ}ȋE+ME+EDEMEPvE^E+}ȋE+ME+EDEEMȋEQMQMnE̍M+EPE+EPnE؍Mܙ+PEԙ+PnUM UE܉EЉEċEЋEMRQMnEEEuUURPX@Q$@QM$xEMuUURPX@Q$@QM$wEMuVt$WXtV_^Vt$W1tVi_^U VW} N?EPju t\5` jHnYYȅɉM u-u WrYYE PoiYEPĒ ?ueEPju* tP5` j48nYYtTȅɉMtHuu:uW)rYYEPiYEPĒ _^3MLk3뱾LʋAËIu3ËP\5` jmYYtLv35` jmYYt.v3ø# VWP<|$ PϋP<誏t WV_^ZVW|$ ϋPEM+EPE+EP7X39uu3wS VuuSД wSԔ jSē E0jS VuuSД EV@PE@PS  ttVVVS G;}؋O ;}VPQS 눋N+NMQE$PdkEuEFu+FMPdWЍHv#vU M@MEE 4WЍHj#SU M@EE  juuS 3PPPS G}؋O }jPQS E;F S t&Ej+EPuSД wSԔ jSē E)E뻋N+N MQE$P`jEuEFM+F PuPVЍHj#SU M@EFEF E E juuS 3PPPS G}؋O }jPQS E;FS t"juuSД wSԔ jSē EE뿋D$I0faAƚfPfQfP fQ fPfQ"f@a(fA$fA&fA*f3A(f3Af3Af3Af3A&f3A$f3f3A f3AfA,UQQVEjPEMPEM %uu%^VL$hM ,t$^UQESVW@XF0jP*u5EjPu"9F0tOjSu uSu]t{ tSh_^[FjPU4VWhjuMuЋpu;EVP`u)EjPMduf}tf}tSM_^jjMEPEPUS]VWj~WEuG?ƚF0tAfF"Ff+Ff}F fF f+F$f}FE_^[]} jXFF Ft ES׋jjPUSVu WVMjB4 ELP uuE3ۋPu*9Ev%@9E}EEWËP)}u u u uu2FuLt u _^[UQQESVW@LXEPvEtRP F0jPu8EjPsu%9F0tRjFP[u uS]t{ tS_^[jFU SVWhjuMG ~0]t Etf0u'9^0tFjPM؅uESP؍M~0 _^[ USVW39} ى]ELuEPs;ljE u  p}}EωuPEu9v5@;}ƋM؋ESP!]+P]Etu  uu @Cuu EL cE_^[U E VWH@OGwQPMDPEM#يEEɉGE#Ί HHO_H ^V bLD$tV-MY^ÃÃU VMWM4M^3A333t1 à L$X à L$X D$V" tVLY^Ijt$ t$ P,D$Ijt$ t$ P(D$I`EPM$P_^U0E V@Q$@QM$UXEQ@$@QM$EMu PsP_^ UE V@Q$@QM$WuEMEuEEQME( q^jt$ h t$V3ҋ9VLt65` jTNYYt6)dfLu NPHPFPut$d^3͋Vt$ u t$d^jXIPt@USVWM3*\]EPhjdEMtMEPEPFPEYYuuEPtMtƍEPS YYuEPfd܅u _^[VWP|$ POR t?SOFLPR NL3ۅv!t13VDRWYCYNL;rߋvPu[P_^3U`VWMFDP]Q$Q$QM$i\FDQ@ e$@eQ$@eQM$ZEЍMPFDQ @ e$@eQ$@eQM$ZEMPZEMPEPwEt1 tuj_tfEQ@@EMeMeMu$Q$QM$NZM ڍp#֊QQPQ@ A _^3t$YUuEPuu u]UVW}OfVRPOFQ$P OF Q$P F VWEEYYHQ$P _^]SUl$ VWU,E$K(C$E(PaEDjȍ{dٍp#Ί KHKH@CLEPٍp#Ί KTKTHKX@ C\E`C`Xud󥍵󥍵󥍵$$󥍵dd󥍵󥍵ȋ_^][UeV5` j0JYYt+Q$Q$Q$QM$YP[^3VWP<|$ PϋP\Puu$Puu u4Mw_^USVW]AWMOMOMOe1 ME;APRu ؋ˉ]PPMJEjEEEEEEP}EFhE;C\PR؋ˋPude/E;C#Pu RPMnJEEEEEEEPlW}FE먋]zeE;CPu RP|JEEuEċEu EȋE|E̋PPMIEEEԋEE؋EE܋E;C}s!p/ EEM]EE]؍Ej PEMPEPPEԉEE؉EE܉E-EE]#u)hLP}Љ}}~W3_^[3hh VQQP;?p PP8Džp }Љ}}WUeS]V]u mW}EQ=1 U]0 G n @ $GQn@$GQMn@$L0 G F Q$GFQ$GFQM$LVM3OEMEMQ$EMEMQ$EMEMQM$SL0 EMQ$EMQ$EMQM$L3vw1 EMPEPpPMyPMNMEPusTu؉Eu=EMPEPG0PMWyPpQN;upr_^[3D$Q@ A $@AQ$@AQL$$iKD$U8SVuMWFt1 ]Sh;3WPWVuhtDjuUQQVuW?tjX_^3VW|$ ϋPuWPD_^AL$+A@AL$+AD$PQP Q PQPQ@A3VQD$tVY^5` hYYt]35` hYYt]3øN VWP<|$ PϋP<:t W,_^ZVW|$ ϋPGLNLP=t.GlNlP-tnjWtjX_^33VW|$ GN(FGFG^G F G(P=G0NLF0G4F4GLPGlNlPPwHN8_^U VMUWRj]PLu&EFtNHtAHt4Ht'HtHuI^w3 E^u_^^s^t^r^wUhSVu CHW3Ή}}ȉ}E}}܉}g{$ t MC(P(CbYP u)MURREPH;_^[M8RjPL;u݅@C4];ljEt Eܽ@]jC`YPxx IuCEPEPCtCTEPQQ$yKTStChKd;~|0u J)MyEE ؉EtMjjEj PhPujs3I}t{uC t j-EEuu SME3O9 t@quiVL8uu SV" sD$tV>Y^Attt tt3jXU$EVWQ@` $@`QM$9E Q$E QM$#@EQ$@EQM$}j^;rv33҉uȋ҃eʃeMm}e Um}e e]UvEsE]wEE0EF;v_^EUHSVuWQFf $FfQM$RE Q$E QM$<@EQ$@EQM$ }e]}meQ]$mQM$EpQ$EpQM$M3ҋeQ؋+HEEm$e+ȉMQmM$@MQ$@MQM$F EQ$FEQM$fu EM#QFEFEF F E$FEQM$*E Q$E QM$E`Q$E`QM$ EM#C;ߊFEFEFu4E3ut(}+}e}mM F^F^_^[VW|$ N3;Ot-t)GNPDtF(_(uF,_,ujX_^3VW|$ F$PFPWYYYPsfVYYORP蕍_^L$t$PD$Vt$WNjPV_^VW|$ N3;OtDt@QQGPNt,QQGPNztF_ujX_^3U0S]Vu WNF+KE@+CQMPjx_WWH@MEQPMN FKE@CQMPzWWlmM+HQM+HQMWEԍMPEP,QQEP M`LEl8LPEPvuPxv vP̀} }PE Ph=L?PEPMvvPMv uP0耀MPWh Dž02 @4}ȉ}EMLPEPuvMPMv v>P] ]PE PhDž2 $}}tlL;PEPvvPMuvPPWht)]j^MESPCMESPp_^[]3UQVW}FEFPFPWYYPEYYHQ$P OfVRPU_^L$t$PD$Vt$WNjPV_^VW|$ F;Gu:QQGPN]t!QQWNDtjX_^3VW|$ FPFPW/YYP'fVYYORP蜉_^L$t$PD$Vt$WNjPV_^5` jXPYYtV35` jX2YYtV3ø# VWP<|$ PϋP^] Vhrj EjH  ^5` hYYt35` hYYt3ø8P 33VjjhGv ^Vt$;t 0V^t$ t$ t$ Vt$ t$ ojX  ^VjjhGv |>~3t"t u*dž ^dž ^dž^É^ËD$|8~'t t u$j jjPj ڋU,SVW}j Wt jWEx EPW uEPW } ] EuvC;kEԍ}ԃ3Ou EP PEPs3u }uWt uWx uW uW _^[j EtvxPГ CU h RS j+uRS+RPQWؓ uȓ {SVt$Wt$Vt$|$ufu_^[ j jt$hNq $. ËVH D$tVY^(. ËVX _D$tVY^5` hhzYYt535` hhYYYt3øP 33Ud=Г ;tPu׋؋E juuPjp0u tSu3M9F)_^[UeSVWv xWYWSv $39`MSM}}EPEYt= t& t!e}u E+EMEMу}u}+}M}u}+}Evv+QPSE $3IujjME_^[Ëu 5t݋SP\33;;ˉMtSWtSW막]UVWu~tEPW(_^]Vt$ t$ 5|$ t^UVMRv tEPJu uv M@^á . Ã5` h,3Y;Yth@RRRRRA35` h,3Y;Yth@RRRRR3ø Q 33USVW@ EujE E EˉbW` }t+u7}t*u#_^[]Wh@!WhA!VD$tVY^V` dž   ^UE SVHWMHMH @jME PEPu5 EMEM}EtEPu jXE)EE)E@tVMWM_YM$PQQEPcJtEPMc5P E P =Г PuE׋ jEPEuuEuuuu Gjux ME)M!epPjQT;u$(+(뗋(;}39JJ{+tqT;of(Fƙu+뇋QT;uS@uP+($+;|jB]NMMNMN[NND$+t HHt3D$!r(v ktmu3V5` j\YYt>Q#ʍQ#Q QV^3^Vt$W:^VWv t FPP  PhW _^VWPte @T_^Í N VQQt$bEtt$HjPxU^UQQV@Tu  PMEP^U|VdžFtAP QMPx M u EP(v ^3UQQVMPdhMEP^U9u65` h輱Y;YQSVPCxEC|;։)pz+Mj+QPuVW| ۃMۃMۃM ۃM {CtEEEME􉃈E.EME􉃜M EM _^[3+M:+QPM?P8UQQEVWH@E9EMuTMQp$ uȗ M }u%t;FuE83_^E8E 鋎9Muޅtځ}uэEPq uȗ ;A$uM Vt6t-PtjtjPx^U4SVW39u:5` hY;YVWP;ljtnA9xuNQM薭PM聭PM],WvŰRWhPhw _^[3|VPl^Vt.Pltj^UQQEVWu jH@EEPVuM } u-hVj V t@$;uP _^EM PuuUAlVWt=qt}𥥥t$A`MjQjP Eu_^q ԋURPT؋T$V3Wt"t uu P_^ P%t't8RuكVt^ jPh^VWtx$0 ;u jPdt$t$_^VWt$t$t@$tP _^UVEPv MQMQtjX^USVu W}uu ٥j PEPuMtjäRSu_^3[T$S3VWtIɻtr;t;uz u!u J;t;uR t t tjX_^[SVW|$3ۃu_^[ t t9u$(t&u @$;tP 뼋Wt %t'uVt$W3u _^ t tVt %t'u؃Ӌt@$tP VWt$ 3tv _^΃u~lt֋PlV~ltu^t$t$UVW}G9F uN;Ot#eeMEGQMEQW,[_^UVeejXEEt~ltF`jPEPR^v U4V39Au\MPMPM&~lt'F`jPE̋PjhPhw ^v Vt$ t$ Rt t$P@^UESVW3Nt39uu3tuu u_^[] ExwuՋtp$ V5` h.YYt ^3^V5` hYYt ^3^øP 33U4VWuuu uvБ M葦PM|PMX%uMQu$_^VWt$t$΋c_^VWt$ t jPx_^VWjPx_^Uju tuuu RD]uuu ul T$L$HPT$ 3ɉHH PHHH H$  V2D$tVY^D$VpHQv$ԑ L$ t ;F$t^!3UEVH@EEPMv$ EPv$ uEuP ^U(S VWh YV =p uBj 3Y}EEܷoPE]UEEu ` ft p E3WSuHX u @++SPQRhh w hu Wp ;ljF$u 3_^[ VWP P$jv$X V0 ;F$u v$ ^3U8SVWFNEPOEM+EQΉEE+E܉EPE؋UM=t p EЋEMM~MUEt8j3ɉFQ5 jv$uPQuhPh$w hu QӉFFE~t8j3ɉFQ5 jv$PuuQhPh(w hu QӉF FE t9MQP E9E~T+EM;M~MU+U+ыM܍L QPEP Ej+EPE+EPuuv$| F_^[33UI$t)Eu PUPUP @UEEPQ, t$q$< UQQeS] VWSFtREPSu)SuPF}tP_^[hSNuuv$ɋNURWUSRV tWV t$ duP^PUQVW} W?tCE PWuv ؑ WuP _^hWNuu v$:NURj U WRV tj ̓|$u q$  |$u q$  US] VW}EPeeWSuv$ZEN-H-tqHtJHM趩ljEMEQSP0}tWSuv$l EE_^[ MsljEMEQSP,뻍MOljEMEQSP4뗋ˋWQQP<냋ˋWQQP8lwu v$ MQVjjt$t$ D$X ^ VD$tVʜY^X V FttP̓ z^5` hFYY3;t QQQm35` h YY3;t QQQG3øhR 33VWt$t$et_^VWt$t$t_^UQSVW} Wu6tWO QuSPHfFxtVuRURSU WRV t5OG Puhv SWuu v_^3[ItqÃV5` j՞YYt~ff { ^3^V5` j袞YYtKff { ^3^øR VWP<|$ PϋP_^3U } VW}uA7u.Ej Pu tEPgYt PNpt uWuu u_^UPESVWtTst -tHuu u_^[ juu h~ptы萒ȋF3ۅth} uMQP MQPLP\PEPEPWt5uWuCiEPv WPPj_U$eSVW]uENE_^[tMtGEj PS t-wEPYYuht~jS SEMEPVt$t$  3PPPt$jPPt$$ ^USVu W} N<EFIE@{ MEPEPuE  @{ EF HEPEPufF { EFEPEPuBFN E{ HEF MEPEPu }}{ @EFHMNIEIMPEPu @{ @EF HHEPEPuF { HEFHEPEPu~F { HMNEF AHMEPEPuI { u FF uGG>~ _^[UVuVu u9E uv4{  Pu u Pu ^]U,SVW} jWܓ 3S hWE SWE EEPju( uM؋F+++؉EF M++F+؉EuГ uӃ}EFV hFfu+uuRV+RPQW=ؓ uuӋFV h&"u+uuRV+RPQu uuӋFV hFfu+uuRV+RPQu ׋} uW uW }tuuuȓ _^[ȉ]NFFȉ]N V hu+uuRV+RPQWؓ U SVuEWPj36( Wjjuu0 M ;lj WӅEWӋ؅tv65Г S։EE 0u։EEtdp0S = PS׉E3h3PPSuuPPuؓ uSuuuSSȓ E 8uȓ _^[øU`SVW39}?FQ$F QM$h QQPPP诐MPEPQ$QM$әPMPp9}u Wj'JE_^[}u$ 9E5;twLdΉEhEhdLMELtjWNE39]uCS SS@FWPSSM1PM PLEWMj3I9}u uEEdEh9}uؑ 3^SLE-W#MECQ$CQM$h QQPPP荎MPEPQ$QM$豗PMPjjW9EWL;t";;tcJ33FQ$F QM$-h QQPPPʍMPEPQ$QM$PM7PMPsP,VPdVPdVPd(VPdU V蓧Eu>WS5` h襍YYt.u)uEL苫[_E^ 3M鋀TTQu !Yu4MPgMQuW|jxhx ,MP'MQuW|FXPU|SVWؿLۉ]MŌM轌jPhRMhv EuP  EMP诌PM荆Qu P胺SuJu!u u?uu P:u']jM M_^[ U$EVW@Q$@QM$-j`I 8EPQ$`I QM$ن(PQ$`I QM$P_^5` h45YYt3VWP<|$ PϋPVTYUQQVEjPEMPE 5 uu ^VL$h D$tVY^33 APÍAÃ3V,#^ø3 V8A .D$tVY^ V D$tVY^ V8A D$tVYY^33333   3333øS V5` j$‚YYtkN 臋` ^3^V5` j$艂YYt2N N` ^3^øPS VWP<|$ PϋP<腤t W_^ZVW|$ ϋPt W_^ZVW|$ ϋPTP3/_^[VPSVt$3tTt ^3Vt$tTt ^3t$΃t ـ@V$u P/D$3HtrHtkHHtctZujYن$ Tls*ن( w( Q$th^jjj3UDW` h VuS~\` Fh N [ h `  h Nh ` h Nh ` h NX^_؍EPEPEPEPEPtE395}EuV;\ } V;\ ` ` 9NXF9NMkۃxQ$ۃtQM$fNeyL]YLE3ADNPEP衉ЍHE#у~XUЋ MЋHeEMԋ@ eʉEE1 |UsEE]FXENE;ALg3h h 3Tыl t[D$WVjp (l p,l p0l p4Y󥋊l pXtl ^H_T$ ;tj\ sT$D;tj\ SVW|$ ;t(X t Phuj\ _^T$;tj\ UQVWuP@Etuj\ 贵_^D$VWH:|uP:}u P:~t.P@RxPQj'j\ W_^D$3HtAHt:HHt2t)ujZTT$;tj\ jjj3D$ؙtD$j\ ܴT$P;tj\ 輴UQVW39}}&M  ;tj\ 茴_^EPuuEM ;HttjHtu\ @VL$WWgu(t$ pPɩj\ _^D$Ph `HL$ UQS39]VW}Du fu'u aPYj\ 螳_^[EPu,؅uEu HwfuыEu HQaju\ ?U SVWu M3{9]t jX9EtE}}DMWfu(EP\oP=j\ _^[E Pur؅uE M$PmfuЍEPE H$oM A4P:ju\ wUQSVW}3ۋ}Au cYYt$u  j\ ;_^[EPW"؅uEPW؅uӋEu LcYYtEu P[EYYu H萼jW\ UQVW39}}-M;tj\ 萱_^ EPuuEMU ;Hu;P tщHEjuP \ pUQQeS]VW}G} QϋP@E t"W{ej\ E_^[EPSEuEPSUEuЋM} QP@E uMXQP@E tEWmEWHzjS\ jUQVW39}}-M ;tj\ (_^EPuuEM ;HtjHu\ US39]VW]}/M ;t#j\ 谯E_^[EPu$;ÉEuMu 9qu)SSMTM;PuY;PuN3;tqSSMSMЁpj#uQQ@A\ DejXU SVEWPuEEPulEuxEM};Hu;xt`U ]҉x#ӊPHEMLHM RP SE PEH贀ju\ E_^[UQQe}SVW}C] WˋP@EtS}j\ E_^[EPu~EuM} QP@E tËEWju\ USVEWPuEu}EM}D;Hu;xteU ]u#ӉxPHEPiMP@LHM RPQE PEHbju\ 9E_^[UQSVW}}P_^[EPWg؅uEPW؅uӋEu ^YYtEu H@PTEjW΃H E!X\ UQQSVW339]}NM Puu  tuju\ P_^[EPu uɍEPuuEM PuEu WEu HC yUQQe}SVW}C] WˋP@EtSj\ oE_^[EPuEuM} QP@E tƋEWHju\ AUQS39]VW}5M Wq&uu Jwj\ ٪_^[EPug؅uEM HP(&uЋEu HHvju\ yUQE $ VWs M_^EPuRuEE ؘ@@t͋E ju\ UQS39]VW}9u 7O[YYtu WSYYj\ _^[EPun؅uEpDu [YYtϋEu DPdSYYju\ |몋T$ ;tj\ mT$;tj\ MT$;tj\ -T$ ;tj\ SVt$W|$NhGLPuPiPNL`$F4ۍWH#ڊ؉W~@ۉP#ٍW @G#ŠF(F(GF,D$@0F0VP,RYY_^[UVW3h ;tnMQMQMQMQMQtE}uYE;\ uN` 9t@h P;ljEuLEPHY_^PuYYM萆׋M+;UQQVEjPEMPE( Buuc^VL$h( It$^USVW}PPPWYYPYYPyYYSئPʦODP$OP$OP$O P$$PWMYYOLP$OPP$OP$OP$OP$OP$OP$OP$OنQ$P PPWYYPYhYPWY YPƥP踥P誥OP$P莥P耥PrO P$O P$ PWR"YYO4 P$O8 P$Oن< Q$P H P@ PWkYYPcYYO\ P$OjP^4EOfRPMuOjPTEOfRPMuOfHRPOfRPOfRPOfRPOfRP[tW蓚!_^[]ËL$AtPRP@RPҙD$VN tV FY^VD$tVEY^SVW辩\$gw@ P$t#Su_^[VQDYVD$tVvEY^VF@ P DYb^jXËD$Ht HtjXjjUSVWj[3M]}IEHHHtMt$E ]8EPCYMCE_^[NWESPѻ;uҋMPhM }NWEjP謻;ujj4 ] ;ljtMPP3 3 MPheiFH;XUR;DE@Pj4 ] ;lj*}P Ѓ3+ȃ3 UQV3W!E}t URWP|u9Eu)5` j xGYYtVtxt 3_^3PC'YLU$SVWMFMEܸ Pu` M܉}cus5` jXFYYt| EfLu9jPMu(M~CM~4uREPAYM}PMA_^[3뇾MU,VW3!}h v X fMQPu u Ѓ3IjDPReu Mum9}uhE tFpM0DE PEPEPEPEPEPuu uuuutURu_^EPjuS nu PuMu EPĒ ;|$u t t$35` hEYYtQ$;35` hDYYtQ$3øS 33U VWaD~ jd_EMF\P EPE ADiM@_^UQQVEjPEMPES Iuu%^VL$hS Pt$P^VW|$ PF PFPPYY tW_^VW|$ OvP$F P軝OنQ$P tW_^T$ Vt tu9D$t$ tFHt;Ht0Ht%3ɅtRqtHt V^Ë,Ջ(͋$ŋ UVu gt ـ^]F6EET$`9t jVP_tID$rH D$wD$ؖ88tj^@ D$L s"ؑDDt(jP D$wD$T$49t jT D$rX D$wD$ؑ44tjT$D;t j T$P;t j T$T;t j \ D$r\s D$wD$ؑ88tjT$<;t j T$0;t jD$L s"ؑt(jP D$wD$T D$rX D$wD$ؑ00tjD$L s"ؑ<<t(jH D$wD$D$L s"ؑ@@t(jH D$wD$5` hPw?YYt謣3VWP<|$ PϋP@4tYHtKHt=HE t/UUM3]̋E E 붋E UQQeSVEWPuMmYY5` h:+YYEL#NjE  Ot MPzAExLu&5` h*YYtuMPʏE@L#u)ujjuE 4EPw%YEPm%E Y_^[3(3UVW u5WMEEMHt/It$ItIt3 _3^Ë,싀(䋀$܋ U V Q4ffMffefMfN0fefMMQjfUXf}u 蘀^øVoD$ L$ Pr F t+It ItIu , ^ (싀$䋀 ܋ y<u t$t$.5` h(YYtI35` h(YYt(3øV VWP<|$ PϋP&EuQ$EuQM$"&E d Q$E d QM$&EuQ$EuQM$%MEPEP&JE_^[ F +G EF+GUSVWM7MQuM%M %MEPGHPE( HME܃TPWHMIPlJ]3vi39UtuċMRMP>KE荍lP>t,EQ$EQM$$EP@E( GE ;rMY3v?t<3RMPJEPuGE ;r_^[3U4SVuWj΋P0u h h, FMPFP}PFMPFPfPMBPSh_^[UpuEPppEԉEEPMeEPMLfEPM I?MfE@EEPM#fEPM ?MYfE@EEPMeEPM >M0fE@ EEPMeEPM >MfE@MA+EEPMeEPM >MeE@EEPMteEPM q>MeE@EE@ MA+EEPM7eEPM 4>MmeE@EtPM etPM >t;eMdMTUVM!M!E( t(M EPFHPbEM ETPVREMFMEPGE^UeSVWfv`}tbE3RMPGMGQ;;|EOP;;}"EE 9]r3_9F^[3F UtSVW(,399MQPEPEMPi~5Ή^EPMFU]CJ;Me;|^EKP;Q;|J~~u&CQ$CQM$H EMP(tjX_^[36E *ȋC;EMM'U;|CQ;;| E)KP;ʉEEU*;|#EKP;;|gPEh PEMPZ?Pu/_^[Vt PH^øP^SVWu-tPSt P_^[ËVt Xh^Ãt^3^V|ttP7^3U@Vh XM+FXP+FTP4}uj}ud3tPEPEPvMDP5EMPEP>EMPEP>EP輙N^jXUD} VtUPFLPEPM؃DP辍EMPEP]>E̍MPEPM>EPEh Xu uxM3^D$VX| tVW Y^VtP|^ V(y lD$tV Y^UVVhPuM=EPuP3^V(y D$tV Y^t$t$PVt$΋PL$ F^3t$PL$D$VX| tVY Y^ttt$t$Qt$t$RXUS]VWWP@EtS&j P`L_^[]5` hxYYt@r3VWP<|$ PϋP<0t W_^ZVW|$ ϋPP_3^UXVMgM_E( M EPP5M E PV4M,6h Q$h QM$YEeQ$EeQM$=EMPm7EEQ$EEQM$E܍MPE7MEPEPHE^UQVfN0fefMMQj k73^UEM MMM3]UQVfN0fefMMQj7f}u ^^øUeVWP\,PPwEPu裘YYu,uMjPPPyEPdE YPj_^3Ët$V3 FF FF^VD$tV6Y^V !B^5` jYYt35` jYYtu3øX$ VWP<|$ PϋP<(t W_^ZVW|$ ϋPo_^e e"3`VW|$ OfVRPv @]QtWS_^5` j YYt235` j YYt3øpW 33VifP4 ^ËAt$It$ZIt$It$+t$ It$ t$ N t$ It$ t$ iY t$It$zt$ It$ t$ س t$ It$ t$ H t$ It$ t$ TH t$ It$ t$ H t$ It$ t$  5` j YYtf35` j YYtH3øW 33Vt$ ^V&D$tVY^V ^ fYYt%(> ^3^V5` hYYtS%(> ^3^øpY 33V5` hYYt%(< ^3^V5` hYYt$(< ^3^øY 33V5` hfYYt$(: ^3^V5` h8YYt{$(: ^3^øY 33V5` hYYt=$(8 ^3^V5` hYYt$(8 ^3^øZ 33D$Vx tVY^D$Vx tVY^D$Vx tVY^D$Vx tVpY^D$Vx tVSY^D$Vx tV6Y^D$Vx tVY^D$Vx tVY^D$Vx tVY^D$Vx tVY^D$Vx tVY^Ht 35` h6YYt:35` hYYt:3ø0Z 33UVu tE]E u@M@MEP]觑EpE uH]ΏE s ^] vU@E SVu@ W^@$uF EP9ЍHu#ъV N@FU NjEu^PhEEQ$EEQM$gE Q$E QM$EEM^#QϊCECECF$uF ^ ENEQ@$@QM$EM EPEP]_^[USVW3}SWuӒ99< P5` jYYE}pxpPue_ t( u􋋸FjuEPRduPTjduPPjuEP莏G|PEP8EQ$EQM$EEQ$EEQM$dEeQ$EeQM$HE Q$E QM$&Muuu<E HHu+A6EEEPm] @E m]EMPEPuE PLEˉuE( u܉u 9EMEPY_^[ e'A6EEE]{D$V3t0t~~- t t#^tj^tjUE S]VWۉME }3ۍM( ESulMJG(Q$]G(YQ$L]YEOPEPSS0QM$Wu zMEMPWEQ$EQM$GMEPEP}EPωuEQ$WMYQE]E$蹺MYQEU$EQM$EPEPMGEPuEEQ$MYQE]EE$VMYQEU$EQM$MEPEPEPu EMQE]EMEU$EQM$;MEPEPEPu E1 uEP uuMCS;} }_^[UE eSM苀VWMEje]( uEuH4M&F(Q$]F(YQ$(YE]PENPuuQM$VuRMEMP/EQ$EQt$uEPtPwCEt] EE Ee CEE {Ee hE}EQ$ŶMYQE]E$'MYQEU$EQM$UEPEPCEE }Ee CEE Ee E}ZEEQ$ MYQE]EE$iMYQEU$EQM$EPEPCEE }FEe 3CEE Ee E}EMQE]EMEU$EQM$EPEPTCEE }Ee CEE Ee rsE}tEME1 }EP }ĉ}ME9E} }E_^[؃e؃eC؃e؃e뎋L$VLz~tPp~^3U S]VW}u EPL#3ٞ E EϋEE PEP腌j؅*E<t u(j&jE_P}. EP} 5` jxYYE } e3 ju uPdu PTjGuPPEP蹛@؞1}tEP蓛@}ٞE9ErE@6EE EP؆ٞYSf@6WfE dنPQE $E QE $P?r;s,SW)PQ$Q$PZu$5` j$ YYtGljtjVuuuąEE_^[e `23U0VWuuӄF(SQ$ʲYQ$F(Q$AYQM$EP u-uVuV]MdEPEEPuQ$Vuu ΋Ej}jϋA7Ph EjPu[_^UVWuu ߃taMF(Q$ӱYQ$F(Q$JYQM$P u,uVubQM $u_^5` jH-YYt+3Ëtt@}PpjX3USVWO#}}tzu1PPPQ$Q$P] SWePQ$PE_^[] ] SWf@6fEPQEE E $P,<HtHuنC [ Cئ[ytJu3UQ3VWt}uURP`_^M3QP`9}vޅtڋMQGPh;}sUVu ]t2t.\ utMQjRLu E^3ED$Vx tV>Y^VN NN4F(  ^ËL$D$Vڍq#֊PPIH( ^VD$tVY^VN4 '( F( FF ^V5` h=YYt ^3^V5` hYYtR ^3^ø`Z 33U,SVW}MWu] MH]Mm싏$M])]MmUErE]Q$Q$QM$iЍH#V NHQN @ $EuQF$QMEu$u ڍHVu#V NHQN@ $u F Qu MuVuWu S賨_^[3U(eSVuW}EPWEN ENCE؍KPQQMQ W$W_^[ t$ D$ t$$R D$0Vt$Wt$ |$t$_$__3^D$Vx tVY^3ËD$VjҸ~u jø^Vt$~uj袸~u j蓸^V!D$ t$ pQ F L !^ USVWPPQuOMMMEPGH( P]METPWyMPMuMmE2 tVMkMcMEPGHP]ME܃TPWMFP4=4MP]3vy39UtuMRMPEPauEMPyat,EQ$EQM$E荎PE( GE ;rP3v?t<3RMPEPuOGE ;r_^[3VuPWHtt$jRWt$t$Wt$_^UhSVW&39tk9tcEMH;tEUjRuQWuiEu9]t9]F }E_^[]롉]΃MEEEEP]M]x5` hYYtC#35` hYYt"#3øZ VWP<|$ PϋPiME( yh X^jXVVN^FN^VVN`FN^UQSVuMWjN3;E u _^[FMQP`tuދhH` P^Vt$ VdYL$h] j*D$^t$aa 23t$x  }39AtI V5` jYYtx ^3^V5` jŨYYtx ^3^ø] VWP<|$ PϋPYY!PT*YTYPPPWYYP8YYtWM~_^VW|$ FPuOن@Q$P DPWKYYPGT:KtW_^V賕N N$]fDNH6 ^VD$tVY^VFD P謐YӼ0 ΉFPF$F ^5` hpYYt`35` hOYYt?3ø^ VWP<|$ PϋPNv4E֙PF@uQ$P W_^[QQ{MPF@PMLYPMĹVWP<|$ PϋP<[t W _^ZVWP<|$ PϋP<t W _^ZUSV3W}9tVXD$tVvY^UEVQ$EQ$uu uH Pk~YY^]V񍆘H P4uY#^U$SV3ۋF9M99vvW( EPS'tVنEPQ$EQM$UPuEE}PQ$نQM$*Pu}C;r_^[VW|$ WPTu)Wt$t$WsWPP_^ VWP<|$ PϋPYE vE mE vjE mju E 9]$tkvE mueu]E vrEeueuE]sEȉEUsJ]E]w@EvEeueu]E >EEE % jQ$E% Q$uuuu uDpE % jQ$E% E % jQ$E% A$ uD$Ip$5` jHrnYYtp35` jHTnYYtR3øb 33U,SVMWF4~4E] eF$Dt ^,M 9E5` j,mYYmKK ]39EE]MSǍMSAv$MEX EXEHuIMA  t8A  s A Y MA F,URQ^,PD3ɅMEPhYE}] 8MEQ]P`EJ@ E4U v,ك8Q] E $ EYX Ee EX$E@ v,XMA$ ub E Y(EEHu_MQPhEE\eQ] E$芧EYX E e{A$ ( Qi $cYM뉍ME QPhMEQu P|u EPfYMQu P|u EPfY}\uPTEJvDMFPv$蘊F fQ$FfQM$sE Q$E QM$sE]wSEM^(QP`EtD@(jQ$@ QM$QVuSulV(s^(MQPhEF(, s^(PtHKtKuMjv$E^0F,F0F0 s^0E_^f%$[UMSVWME}DF FQ$FFQM$rE Q$E QM$rF(Q$QM$rЍH#ъU M@XE׆EN4UDž`NRdF$EP`]}EVE؋ẺE܋G EG$ωE t:VN(Q]G($8MYQE]G($9MYE]܋OXPSQv$OdOPv$蔭PEj]]PEN4EURPh7}tjQEċ$Puu SEE_^[ U@VWMpG4O4URP`SF F$Q]$8O(YQ]E$8O(YM]vpE fEj]E \E`]F  wE sE rG(]F  wE sE rG(EW tHF(Q$7]WMO(Ew]Er]EE]E]sEEW,EjuEPEPQ$VzF(Q$7MYWUU]}uuۃCC ]uEWu PE%@E m]E ( mE sEE] E]E( G4O4UE( RPh{[EMɍU#_( ^ HMЉHMԉHEs]Es]hEe]E EE2KUQSVuWWoWΉEW΋F( vHt-HtHEt c@XEAJEBf]ˋ~pxu&X FXFHFLE]F`FP].trtmX FXFHFPE]F\FL]؍EPEP3rMEP|~puDF\EEPEP rMEP{_^[ X F\FLFHE]^t tF`E밋FXEUVWM{_M;e~pX FLF\FHE]F`FPMEPEP]kq} GE] EE Ee GEE Ee jXul9FpFXEMEPEPpGEE wyEe rjGEE wVEe rGjXtUN4 _^X FHFXFLE]3]F\Ee3VWP<|$ PϋP<xt W _^ZVWP<|$ PϋPiQQPKMgM Pj衐Pu_^ UF[^'E$`UE VjuPPEP`@Q$@QM$&SEMEɍU#^P HMHEXX35` jYJYYt j35` j9JYYt j3ø@c 33U SVu W}8 ω] AuVن< p uE5` jtIYYt.u,Eu(u$u WQ$EQ$uVuC_^[35` hIYYu,Eu(u$u WQ$EQ$uVuwQ$QM$QЍH#хۊV| N|@KE(E(džCQٞG G$GG Q$GGQM$V|L EQ$EQ$EQM$VMUɍ#ʃ}, MEEG ئQ$GئQM$P؍Pۍ#ڃ}$@Gg ٞtXGdž} u(x نن؋,3se(G džGئ}0Q$tvG ئQM$P؍Pۍ#ڃ}$@GgٞtGdž2GGئQM$O؍Pۍ#ڃ}$@G gٞtGdžG džUDVWu MK M>EjjQu$Eȋ>Q$EQM$TEPQ$EQ$EQM$bTPEP3ɃI_^ D$ ق$ـ<%L Q L Y5` jEYYt j蓢35` jEYYt js3øpc 33U M VWjt0PLt%uMsMURjv_^ uM j>bQQPEM舊M Pj‰Pu5` jEYYt j435` jDYYt j3øc 33Vt$~ ^5` jDYYt j435` jDYYt j3øc 33Vt$ ^UTu MM=Y^At( H ǁ1 P PP'~3ËA HVHF M=D$tV>Y^t$ t$ t$ o A H@@VHF  =D$tV=Y^t$ t$ t$ + t$ t$ t$ A HVHF }E% AwAE% uFwFE% Fa EjPQVMkEPQ$@QM$FEPQ$FQM$FPMjPS}u E؋6YLMP1;XLs ?6OLt3GDM‰_^[3UVuEPO4$E^M]UVWuMȉuL} LjPjPMvXtWj贁jωElZE LLt/EEuT u ujjVvPuڍLy_^5` ht4gLQQ$uuP`EE;EZ_^3[U5` h YYt"EQ$EQ$uu u9]33jXÃ3VWhhj9t$FP3 &'4  dž@ dž( dž _^VW  dž@ dž( dž tjtjtjtj tj4%#zO_^5` hT]YYtt$3U VM%u Rt%jLt PMP6MEPlM[E^ U VM%u vRt`MP6MEPME^ UQSVu2RȅɉMtQLw3ۉE~7WMSLtuCMWS'C;]|_^[ Vt$QtWt$BW](_^ VHHHt|HtEfdž5` j,YYt跢P^3싆5` j,eYYt{3 5` j,1YYtG 3u\5` j,YYt[3u)5` j,YYt(3P^U SVWj}؅ۉu/MPPO G4MWG? _^[VWN3= PPPhGPPhPP׍fP(_^ËD$PVHt5Ht*HttHu ^ U@SV33W;u__^[IIItMIt9tRERPdP 3M P29 tRERP P 2M] 뻋;AP 2돋;hҋ;(SV3W9u __^[IIItMIu֋;t̃ Q1WSSWSjWSjWSj3댋 ;t Q1WSS4WSj)WSjWSj봋;6 Q[1W 끋; Q(1WdK; Q0(UV~<tNf}%uf} u d^] udu uuuu uHu3jXUAhE +tHHtuuu q3]uduu SUVWjd]jhU hUhVhVFF<;hWE<tZvbv v׫v蓸vjXv6 >tCXt(0jH,YD$D$;ClS]^_3[Y3VW= h$vh vh!vh"vh#vh#vhyvhyvh$v׋Ή@_^UE SVW!Htu u@_^3[]u^Ћ@Pwt7N:tN DD4GR>jh;uGhNF0v4P:8j;@׋ue ~<~XN3R:9E } u N8t*N/:;SN-:t j.GE E ;F<|~jpS7u~Ћ?PvE ut?PE e~<~9uI؅tK3N9tN DD4CEE;F<|NjP(E hNv4puǃ8VD$tV(Y^VWj6t$4N\,fxN|G ..4#Wj E/Wj 47/ FX F0@ F8< _^VWX 4 FX F0@ F8< 9*9*H 9*9*N|N\3_^5` hYYtt$ 3UQVWLu_^3SVW339~|~ uWNxE;uG;~||_^[VW86/ft$ fPN39G8F$39GHF(1^0L^8bωF@FDGhFHGlFL_^QQSUVWPN81\$3|$ۉD$jXPh#R jXPh#R Sh#P Sh$P  Wh:$vӋ-X PWh;$vPՋ|$Wh8$vPW9$WvPՋ\$3;tw9l$tqjXPh:$R ;ta9l$t[jXPh;$R ;tK9l$tEjXPh8$R ;t59l$t/jXPWR _^][YY333333VWF\~\hVhVhVN80t(hVhJW  *_^ÃuՃ VjjhG  P(^UQMSV3W9^<M#;Yt<t$Iutf9] u$$WE_^[ f} uqf} u,0Wˁ#IIItH]t"It]f} u@Wf} y<Wcf} WPN8.8tDWY1Lf}  PN8z.4t@ǃHf} 08f9] u(G(PP39_(PVVL$PjP^UQVW"j#EQE$adEYYjP_^Vt$ (L$jP^U(VuEWPj ]j u  EVEEPoYYtEt jP_^U SVuEWP>j j u  EVEEPYYt ;>t jP_^[U(SVWw$$<(G(PE(((P339]PG0SEjPEj PQQ$;uEPSj , G8SEjPEj PQQ$;uEPSj 0 PN81,SSEj PEj Pw@T;uEPSj 4 SSEj PEj PwDPT;uEPSj 8 GP>.jS@, GjQ$bYYP jS<, _^3[wHS;uEPSj 4 SSEj PEj PwLTSU39k|WVUKxxPK8(39F$P39F(PA~(uFF0QQ$F8QQ$v@vDvHvL,VvE;k|^^_]3[ËD$x^$uPD$x^$uPSUVW= hvh vh#$vh#(vh#0vh#,vh$4v׽^$8Uvh_$<vU@vPN\m@.Y%_^][Ã|$u D$HЋ@P(38VD$tV-Y^t@t@$jXËAdSVWj4t$x"N`j[Nd^\ %3SWWh(#9SWW(h)#9SWWh*#9SWWHh+#9SWWh,#9SWWhh-#y9SWWh0#f9SWWh2#S9SWWh3#@9SWWh1#-9 F F0 F8 jX_f f f 0f f Pf f pf f f ^[V񍎨 F F0 F8 PPPPhPPHPwP(lPaPyNd_ ^5` hhYYtt$ 3US]VWSyuN!E}_\j0Yt2NN G`UFRVSV3څ}_^[]D$SVt$ WtM~E@G`O8PF#VU PXpN_^[G<tV PeG<(ϋVL$ڍq#֊PPQPQ P IH84 ^SVWjFd~d[hUhUFl$u6W qt};N\uH;N`t|9(uG;|_^][UVW39q<U5;ot\'t@Jt-JtJu|f9u u=Pj-f9u u'Pjf9u uPVf} u_^] f9u u򍁨Pj볁$JtxJtXJtEJt1Jtt3f} uf9u uhPjf9u uPjf9u uHPVf9u sPj.`f9u V(Pjf9u APVVjL$jH P(PPjt$IjP^VjL$jH$hPPHPjt$jP^Vj>L$H(PPPPFjt$jP^VhP8F\ttjjhG8 HHF`P(^UVWjMXEP<2EOP>ujPM=_^Ã|$L$tXbUV񃾔t>MEP<ujȃM^VWN8#jwjj < 39G PPC3 P(P+3 PP39G$PHP3$PP3$PhP39G(PP3(PP3(PP3(PPm_3^QWyd$VUSt$Mlt\th~JEvO8苅NQPTFP蹷SG39FPD$D$;{[]^3_YËGS9x`u Gxh=dPjW, _^dPpSVW339~#uWf;N\uG;|_^[ËD$tIJt;Jt-JtJuI<t `QHASI<I<׋I<(̋I<,UV_t/jYMt,H`M QHljjP^]EtH`M QHt̋M QHDVt@`dPHP(jP^VWthPG@jP_^U$EVPj j  jjEjPEP}QbȅtAT]tEjATP^VhP7F\P(jP^USVW~<M#;-.HHHtnHtZHt?Hf} u(؋XjP_^[] f} ujf} u׋f} uNjf} ujf} u0f} ujf} uy3r SUVW~8#39n\}(;?6F\;ff-fPX wGlP, jUӋGtPjUӋGDPjUGTUUjjD$ j PQ$OD$PUj  hNjw@j73f9Rh.P 3f9Rh0P _^]3[ Én\VW39~GSW>bt*tRItDIt6It(IuN<t PRxG;|[_3^ËN<ًN<΋N<(ËN<PdSUVW= h#v׻/Svh.vh0vh3vh1vh2vh4vSvsYaYOY=~`YϋhU苩hUhUshVghV[JUjW QSjh| 4F|~|hRhRhRhRhRUjWS Sjh|  _^][Ã8VD$tVY^5` hYYtt$ 3Vj2t$ A N\ܧNxN|38 F F0 F8 ^VN\8 F F0 F8 虧 ^ËD$VWt+t&HHut$ ~Ћ{vPvt| _3^D$ HЋ@P(VWG\w\hqRphsRdhuRXhwRLhyR@h}R4hR(hjV thjh}  hjw| _^VWG\w\hpR踦hrR謦htR蠦hvR蔦hxR舦hjV thjh(} ] hjw|i _^ËA<t @<UQQSVW8^8jxt}jwˉEGf=|FtBEP?ȅɉMtj7;tj_Ef9E~F<_P^[3눋}띋A|wS$}=A|A|A|A|A|A|A|A|A| Ãa|0=x=@=8=P=H=`=X=p=h=|=|=|=|=x=|=x=USV]s8Ήu$ fEeWj EPYt EEjXf9EǃE|@t<]MS t;EDt EE]fEf;E~39uFf9E~@u7@f;E }(u; u ǃBf;U|f;E|V6Y_^[VFt N<F؅t[X @ ftEƙu9M;(E싛\ @\;uESuhQu E}Ef9EoME_^A\E[=3SUVW39~l~4l$},WNhXIt} N\A9t | M9uG;~l|_^][UQAXEt URPQ4EHVW= h&vhyv׋Ή_^ËD$tHttHu D$H+3D$HЋ@P(8V觸D$tVY^V6D$tVY^5` j 3YYt-35` j YYt3øR 33VFt P f3^à à  VW3t43P8~)  VGt H;L$ t  FP8;|׋_^Ëx UuYtuuu ]uuu ul V5` jYYtff j ^3^V5` jYYtvff j ^3^øXf VWP<|$ PϋPEuwFQ$F QM$uh QQ>PPP7MPEPQ$QM$[PMPuȓ _E^[ Wu̓ Wȓ UQVEttWSPГ SGSYYMt+5` jH;YYt;|;~+׉Pp>;} +׉P_^[;~+ʉHUSVWM+ ]tOCM+F,PC+F(P} }}}jXG uPh ~@ٍG#Ȋ N8F8GˉF<ٍC#Ȋ OOKOK+N<+F8QMPwMQPPNhSAE􍎈PEP]E􍎔PEP]PlGM+F,PG+F(PMQSP`Pttj_^[ 3V5` jYYt葮fN z ^3^V5` j赮YYt^fN z ^3^ø8g 33U SVuW}E H@+O,+G(QPMHGLP!t%~^ EMHw-$ j~ ^EًEF 9F}EM9F }F 9F}F9F~F9F~F_^[ EF 9F}+E륋EFFN;}F덋ENFF;vNkEEFF 9F}EF9F믋EEFF 9F}ENF;F EEFF 9F}+E띋EEFF 9F}+Ehi2iJiiiliiU VW}MϋF@}SڍH#ъV8 N8H׉N<ڍO#ъP HOHPpMSWVEPi>SNLjPEP}[ELjjWH YY_^ U,SVWM} ]tDCM+F,PC+F(P腪}}}}jXG  PpMlMd~@E2 ٍG#Ȋ N8F8GˉF<ٍC#Ȋ OGCMGEPSVpMWQPdEԍNhPPttgf_^[ 3V3øV Ã= u , , VD$tV輦Y^VW|$ GFG F GFGFGFGFG F G$ڍH#ъV( N(@F,G0F0G4ڍH#ъV8 N8@FY^VF t PȐ f=^Vt$t@^ËD$ PVW39~t3_^ËPDP< ;t#FPHuvȐ ~ȿWj  Xyt H uSVWL~tP t(hpt$WPPȑ ;u 4 ~3_^[L$HL$H VFtPPPđ F$ f^ËD$ tPVWjt$D$f ~ NF覭t$ W莩YY_^ AËA@ËAQȋ@V [D$tVtY^AËA ËAËD$Vڍp#֊QQ@A^VWVF8PNPWp_^VD$tVY^VF  P蹟YF  ^UQEVW3!85` j胤YYtXtBfEPjud |%E FEF EFFPu, }5u _^3뭋FtP| f!VDYԋE03ˋ`  ItQ| ËT$ Vt$ W"jYhZ 3tt$jY 3t @_^ D$ PQ3D$@@Vt$NFutV袟Y3^UQESVWt } vuV Ouu3N FNE;}/];} s'ESPvl E|/F EFG9E|ԋEt8E;} F_^[} vuV OuE݋D$L$VHH pP;~ jHX^3D$H H3UQSVuW} EeP'vv؋E }tPQ_^[PQMFAE3UVEWPu 5uYYMQVPu}MWQVP u 9GtjX_^3D$fL$j`H fZIPIt!ItttP@@@ @ËD$VPfFF 0 Q^VD$tV蕝Y^0 IQPËD$@ @ Vt$N u t jPF ^T$ SVt$"WjhZ [3jYtt$jY0 3uD$3ۉPQ_^[ V5` j輠t$YYt.vL$ tVP^%3USVuWNP4+~t>9} s} Et8v)]}FSPHNNR8P[YMYu;} _^[]D$`3Vt$WN~P4+t9D$sD$ 8N;D$_^@P VD$tVY^P ËD$@@Vt$Nu t jP0F^T$ SVt$"WjhZ [3jYtt$jY 3uD$3ۉPQ_^[ jXjXjX|$@u25` j YYt"t$mL$ % 3SVt$W|$3fWPfYf;YuF;GuF;Gu F ;G u0_^[ Vt$W|$WVPu"D$OIttt t `jX_^ PfPRK\$L$$ }23D$D$D$L$C t j\$At3fd$L$}3+L$tul$L$tL$l$Huم{D$\$loD$ VPD$ tmt$(D$0L$4T$8t$D$ D$u$ \$L$ D$T$AƉ^á  D$L$\$Au<u+  D$L$L$ D$T$AƉ^3D$D$܋L$ A?^ËD$L$PQt3ËD$L$ PQaW\$@t=D$ ؐ \$D$L$PQ6W\$@t ø3ËD$ \3SfVt$lWL$ H$tS^D$ PSW u=L$ld$HSFT$PQWL$QRD$ hPIV3>t9` u V)u P_^[\ÿ_UK3>4L$HD$HVT$<D$HFD$8L|UWVSu }Pl xu> t.F'G8t,A<ɀ A,A<ɀ A8t[^_ø3ۋ tFG8tPSg؃]8t3ËL$3Ҹh  x 9t B=Ј rr$ww  Ël w Árw w w ËL$VW9 2 vf% 4@tB8t==% uttt _03^jjl jjjj_w  x ^ËL$; 2 s% @tw  x fL$ ffu9D$L$PQktttøøø3T$fD$ % T$u  fuD$u|$t pÃ%á u  SV3Wp U h, p  ;hx h fx f9  @p Ј t̎  @Ј f= tv= tm +̎ Ԉ  @؈ j@` h| Pn d j@hЎ PY d @?d ` ]_H?^[J?Ԉ 뫀}=h t6ŋh :  tH:J u3Vh PZ+Q^h %++=h jU ` Q肖 ` @}-uU! Ј E<+t<0|<9 EA}:uUEU @Ј }0| }9E}0}}:u#EUЈ }0| }9E}0}t Ј أЈ EԈ tjd UP譕 d @]_^[ád ]_^[Ã=Ԉ Vu3^Ët$N; p u ; O=p {f= 3f P3f P3f P3f Pj3f P3f P3f PQjj,f= 3fʎ P3fȎ P3fƎ P3fĎ Pj3f P3fŽ NP3f PQj3f P3f P3f P3f P3f Pjj3f PQjZ3fʎ P3fȎ P3fƎ P3fĎ P3fŽ NPjj3f PQjj,t V9 ~a;t |U; M;t ~m; }e^jjjjjjjjQjj,jjjFjjjjj P3^; |r;t j; ~ ;t }3^ËF @F @5t 92  u;x }^3; | ^3ø^ËL$ |$ SVWUً|$$4 FQɍ,DЍ2%D$(;T$,hl$+l$+l$,uu{ ;~|$D$45t @T$8RT$< p D$@]_^[x Ë4ĉ D,+tȉ |$$u4 t$0q4ĉ D$45 @T$8RT$<؈ \$@ӣ } \& ] _^[Á= \&|- \& ԃf|$u fD$Ã=Xl uf|$arf|$zwfl$ fD$f|$sD$jPֈu fD$ÍD$jL$ jPXl jQhRu fD$fD$VW|$ G @t G _^èt)WSWGP}G _^ËGtP5TGۋT$; 2 sS‹ʃ% D$t8RPd u t$w  x w  Ã3D$SVWt$Ul$$;t ;u]_^[Å=Xl r=1 umtL|$ UWD$PjU hl VUWh Q t!|$u|0H]_^[Ë|$ 뾸]w *_^[ÍD$|$ PjU hl VjWh Q ؅t|$C]_^[Ã|$ z;sTD$ 1 T$Pjhl QRjWjP tJ|$uC ;w(3҅~L 3t!BC;|;r]_^[Ë]_^[Ë]_^[ø]w *_^[ø]w *_^[Å|$ ffw 0σf9@;r]_^[ø]w *_^[Ã=Xl u|$ WU]_^[ÍD$|$ Pjj hl jjWh Q t|$u H]_^[w *]_^[ËD$Vt$ȋօt f:tIutf:u+B^SVWU-L5 u#=x tt3]_^[Ë-L5 tRt$tJ+у}Yt4}+I;vE<=uSVP# t}u3]_^[ËE]_^D[SVWU|$;= 2 ǃ% ǃ 4D1trtuj[jO;ttV= jjjjjPjj׋t>US؅t9jjUSjPjjׅt.jSM>u3]_^[ø]_^[ø]_^[ø]_^[à = SVWUu&jh  jh  jj$ tc l$@\$t FJu>u+_^Ã|$SVWU7T$j=R9l$} x ؉D$9 L5 uL5 PXL5 =L5 |$t#=x t]_^[Ã|$t 3]_^[Ã=L5 u+jiOL5 u ]_^[áL5 =x u+j5Ox u ]_^[áx 5L5 +l$T$UR/>|$t:PZJ;tCGC;uWVgtL5 T$|$te|$+AQN؅tF|$++ȃ|$ +I#PS\ SI3]_^[Ã|$u=}ߍPVgu ]_^[Í T$A83]_^[ø]_^[SVW=L5 ?t.\$t$SPV u <=tt?uڋ_+L5 ^[+=L5 _^[S3VWt$;u3_^[ÍV>t Aƒ8uP>M؅u j @>tƃQC>u_^[Ã=,3 SVWut$L$VQ:_^[ËL$t$fftB3ҊЄ)2 tQAt93 ;uA_^[;t fAAfu+_^[#3_^[UW}WZ@P]LZ t WP~ZZ_ËL$tAt>u~Ѓ3ƒtAt0t"tuύAL$+ÍAL$+ÍAL$+ÍAL$+W|$L$ tAtbGu~Ѓ3‹tt9t,ttljD$_fD$G_fD$_ÈD$_% VeH ^r^V\aD$tV'bY^L$ff|f=clft$- ωt@ø,w t$, 賉t@ø0w t$, 藉t@ø4w t$, {t@ø8w 5` j FeYYt!35` j (eYYt3øg VWP<|$ PϋP<>t W_^ZVW|$ ϋP ~ׅ EVPYYff=f= UQEP`YEP^@YUE3SVfQEAEAWEfE yUf0 EM}EPYNNNt0NNtNuxEE<,tl]gE@:EtY:i EPa;=맋uۍEWPYY"f?D$YU0ESV3WMЉ]E=VM;fFfF2fFf^f^f^j ΍@@ PEP>;ÉEtB=  t9 PEP;ÉEtfFfFfFǃ? u9]EuE=  Et0 PEP;ÉEtf^f^f^? u9]t9]u E9]t EЋPKMTE_^[UQESVW33I] $epR\E;tE_^[@^@EE@@fHfNfH fNf@ fFf^f^f^Kf^f^f^fHfNfH fNf@ fFfHfNfH fNfH fNfHfNfHfNf@E^=+ؽY½νӽYUEVP jjuEPp |EQQ$s^^A@ jjfAf=uAujYE 3jXUQQVEjPEMPEg uu%^VL$hg 袲t$O^SVt$ W΍GPd΋kt^ ]tV #_^[Vt$WNGQQ$P%tVg_^5` jVYYt435` jVYYt3øg VWP<|$ PϋPQ+uPWqF;~Ru+ƙj^PS_^[] tQF뮋qB~;~R+u9j^P맋AD$VI tVOY^Q3B~ `JuUQQS] VWCj^PE;։u~s89t E9U|U$}qڋ|| }ttqzF~/t x ur}u7}E7}'M}uyG~)p`|`U^ԉ_ԋf&Mu] Q)Ppe ~/p ut u}6E7u&E } ;xu|ދpe F~-T`p`zԉ~ԋ:>b"E upF9u | P uD\L4P D`_^[ u~ًxZO4;~(\ | ]Z+uu'MuxZ4;~2\`|`]Z+uu_ԉ^ԋg'Mu] u|t|y+| >q+zd q+F~t X }>;&Mu] q+F~)t`x`U^ԉ_ԋf&Mu] P)QUSVu3W;GF Vu uO3҉D G@9^~N D 3ۃB;V|O]A9^|'F`L`PԉQԋEXԋU;V~Fj@G^3_^[] UQQSVW~} _^[5` hOYYtRv#O}t8] ;uU5` hOYYt%NAQNujL33p4P A`MNj+Z;‰E}U+ML M3ɉL T8W4TdW`L8PLd;V}3L88Yԉ_ԋY,_,3ۉYԉY,B;V|ڋ] }FEWHuG VaN3USVWP 9EMtv PM tVtP;ut ~|};uu~|rF j3H~~ wP}RFCH;|F3|4;U tT EtDt`L4uRPSuFG;~3_^[]3USVW}tsGF hWu uEEPH3Y9WN~GL B;W|GFgFX@XFXtp\j3_^[] SVqWN~3҅~y;\$tB;|_^[;}DpB0;Q|IAdD$3UQSVWNF~Ze~R~M 7u-u9U;V}NjXB;V|NF3ۉ\EEE;F|_^[ USVWP 9EusM3;t vP^M ;tV4P~H;ut ~|=;uu9^|3F +H~~wP}FCH;|3_^[]V]D$tVMHY^5` jKYYtT35` jKYYtT3ø(h VWP<|$ PϋPCE1 URPT@Q$@QM$FFMQ$FMQM$lFE N Q$E N QM$JFE܋EȋESEu( E؉Eu EE URE/uuu VUXSVWMȃEMEE( @HHt{Hto]MCPKEȋPEP.B1 SMu(EԋPEP BMĉu-jPM'kURu u_^[ uu u*UdSVW} tLWMq_M]WEPu t2jWUh Rtj[My_^[3UDVWu u>Q$Q$QM$%JPQ$Q$QM$ JPMP,_^jt$t$t$ t$t$t$t$USVWMI|gVEe~L^DHL@DME39Et E3uEЋڍH#хUU@U@ U33ZuZu R dj3XZQZCZ U6j3XZ#ZuEZ  j3XZu-EZu"EZ u} E}33QB$BQM$BEjP|NLj3XVDQB$BQM$pBE|P^NLhj3XVDQB$BQM$3BE|P]NL2j3XVDQB$BQM$AE|P]EQ$EQM$AE( E؋EE܍EjP|}M GEQ$EQM$AEΉE؋EE܍EPEP}E]sujM XE1 |Av_^[3o333 3+3b33j뉍|u3USVW}t莚E} FE>F u f_^[]^Su Pt#SU39UtA Q$ju u]9t9Qu EY wEQ$RVۥD$tV3Y^U EM Q@a$@aQM$?E sE sQQ$QQ$ U$SVu W}FWGFU wE GFU r6E ؉E }Wv(Q$QM$J?PW!;] G] vE Q$QM$Gf s_^[ FU_GFU wE GFU r*E ؉E }WvEQ$QM$K] G] vEQ$E QM$#GfVFgQ$FgQM$K>M=M= EsEs؞v|F_sZFEFEGEG}EGeOWMmw|eMm؍E_GEGEFEFF_sBFEFEGEG}EGeWOumv#؍EGEGEFEFeum\E NENs]EEsE sQQ$QQ$}I`8It$P4D$U(SVW{`Glj}kP?5YufLuu%u)uE؋P MP躁E{`Cd_^[K`sdk}CdPʃf-C`ukY 0APouE؋P K`Pki}u둋A`tHA`y`u dQ-YUlSVW39wtD& t;E 9pt=GTPEuP' f;tQO($jw w_^[ ]9stuG8PPt܍MMFjPMFQ$FQM$;PMVFMPVF Q$FQM$:PMVjSMh QMoYU$V~tN, tEM0 EuHu MH MH@M]M܉EjQEC^ UVW uQFF $FFQM$:F fQ$FfQM$9EčMPEP7^G8PEPEPx VMaFdEF EEh KP8tF]F ]dj PMu ] u!3Ƀ} QduuQdCn_^UdSVW~dW}_<S33ʅJ33G4 I Q RMP']Mv8ttYh QQ+ME EPQ$EEQM$4EePQ$EQM$4P|XKYP_^[E mCP@MmaE EEKU8VMEWP/>h QQ1+M)PEP_^ 8QL$YD$TQL$ZD$aa ËD$a AD$AD$A t$t$A$U VWN(_} EWN8F$xGG Q $GGQM $P3ЍH҃d#VV N@Ff$Y_^[t$RUV񃾸1WM?ju]P$EEu]Pu]P@jQu]$EQ$QM$8PM?Q$EQ$EQM$7PMv@Q$EQ$EQM$7PMQ@Q$EQ$Q$M7PM-@>@TDPjh QQ )MPEP4@E fMA_^U8VMEWP>h QQ(M裆PEP_^ t$D$t$D$t$t$t$t$t$t$t$SVWN(3ۍ~(Åtv,P `ff f$_^[ËAdtQ`8kDPoÃU0VQF$F QM$;0FQ$F QM$%0u QFE$FEQM$0F EQ$FEQM$/MEPEP,TE^3PPPjjQL$ UdSV]uM]W}]33];U]]]]]]]]^X^P^8^0^(^ ^^^~0EPEPEPEPuSU ЃNEC;|+}ωMEEfF`EU^tɍy}mE^0tEMIMmE^8tFEEMEEM]EEMF@M^PFHM^X_^[Åu9UEtzV^E!UV(V EEfF`]E]t*EE]EE]EME]EME]t EME]t E]VsVVv%^EV sV V(hV(`VD$tV(!Y^VF fN\HNN NF$Ft5jPv Ftjv YYt 8tFt؉Ftt)F,@t fdž tKNxfdžt@N|t,N 5P  PM<}EPz3^Ãfx뼃f|SUl$ ًEM +Wx3+VSTȃ^_EjHuPP CtE$CxE$C|E %E %$UPsYY PsYY][``@ VD$tVnY^@ 3 VWt$>}3_^豁=~e= }^+Ј D$D$P=Ԉ yV:h؈ L$)D$QR_F ^V8V+Ј +؈ <D$D$} щl$<<D$N<ȋL$V} ׉Vl$<<D$NȋL$V} ׉Vl$D$D$~3FD$ƉVT$V T$_V^+Ј :|$}JFL$DVF D$F _F FlF N^ËD$F_^ÁD$VP L$Q fL$f9 : fD$ f98 fD$ f96 uvfD$f92 uhfD$f90 uZ( D$ R%P3fD$&PD$(%P3fD$*P3fD$*PD$,%P$t^ÍD$$Ph t HL$0 ( AFAI FN a=Xl S\$ua|z [Á}0=1 ~jS'u[Ë 2 3fY3Ҋѡ2 DPt@L$D$ \$ L$jjXl QPD$PhR,u[ø\$D$ ƒu 3D$[33ɊD$L$[ SVt$ W3}3_^[ûЍ+ЍR+ЍFʁ3|)@33|@3@Q  ҍ[ȅ uȉ _ 9} B 9|J  +Q܋  ؋ <ȋԋ @_^[Ћ Ћ  ÿ!$SVWU|$8lF\$<,ĉ l$@u~Ei|׋L$DGՃ4Rq4RD$Ll$,T$H|$$K4R\$ L$Ј U|D$Ptu =Ԉ tD$P~t5؈ ]_^[$ø]_^[$~p؟<zqʜ; RgJwgg <gB<gMg-g4>4> Rgwgggg,-lk lj\ iRgvlwgig`gO@ 0jjk`kkkKjOjTjٓ<c#fffcc bcRgwg>cg\cg=dgg8hjhoez`eehehf1fh5idRdddBqu4>4>4>4>N"lMg-gd   0 Rgwg g* g3 Mg-ga -Rgwgg'g|Mg-gT Rgwgggzr.cvvCv sFs rRgtvwgrgrgtSt8hjh3 uQhuo)hDu{xuh5iKZ?s`2|0L~!ގFY\Wg]:VY/N !,ݳN !@&c8ݳN !:LݳN !RݳN !@r=XݳN !^ݳN !ı54#>q 4#>q  ~sB3"~sB3UsB3`tB3@Z'B3B0?B3wlluB3BKvB37j.wB3 p tB3"p tB30xB37j.wB37j.wB3A!quB3?OB3`+ŕB3lpB3`@B3\oPB3 dJ^B3b_d!DESTPDESTPDESTPDEST"QDEST$QDESTm/DESTpS7b}B3b=B3m/DESTm/DEST`RoB3 *DEST`N+B3nS7b}B3`S7b}B3dS7b}B3fS7b}B3hS7b}B3jS7b}B3lS7b}B3y}#B3[W^DST?; r PJ)1r PJңIgXi%ii4>4> Rgwgggg4>gg8hjh4>4>4>4>h4>ih4>4>4>h5ik4>kړۓ0L~4>4>4>4>4>}4>4>4>:ԋLWO!FLdmVz7([p <Rgwgg6gF&+e Rgwgggg8hN<ҝhih-^huZ>92}n}6wpw wRgy.wgvgvgwgg8hjhyyzzhZzh<}!r}h5iMx!yy!dgܒezg{"!8qu_J!hoN"< ?4HPؤH)k^%]t[a 1XI_;yQ}QQquK6N"G "24>H4>PؤH4>k^%]t[4>64>4>4>4>yQ4>4>4>tquK6N"G "24>H4>PؤH4>k^%]t[4>64>4>4>4>qu4>4>4>4>N"G "24>4>4>4>4>Pؤ54>4>k^%]^quRKN"G"24HPؤHRk^%]t[6%X#IeUw7?cKI0B_=k&[-+:d?>quK6N"G "24>HPؤH7k^%]t[4>6e|cK4>4>n4>_=k&[-+s4>4>|4>{@A{ )? mw!TY RgwggYgZ$w?E[.*Z lRgwgg [g[GMg-gR RgwgggeJ=x|cfqmA"^ae9+*lMg-g4>4> Rgwgglge mnnn=Kmx|nnoomo"^[fK,LW+;/d 0Rgtwg gY;gWF:ިQMg-g Rgwgggy:-@)?W0-nldLW_;R`ZI &Rgwgg;gxLW+;}||{$| {Rgwg{gS;gWFs:f|u8-   RgwguggJ^x$$UMg-g5SoS SRgwgRgRg`TeJT=x|c'VYVfqWW"^RFUWHSUMg-gI%J IRgwgIgIgJeJ4K=x|ctKKfq L]L"^lIF7KKHmJ@MaMg-g%% Rgwg$g %gNKMNX֛1Ȭ(>N  w!!pXu 2&uJII8,4"Rڝ{ɟ֝`Mg-g RgwgyggNKMNNNlȬ(>LWpXu s2&uJIs8,49R{`Mg-g$$ Rgwgp$g$gNKMNX֛1Ȭ(>N  w!!pXu 2&uJII8,4"Rڝ{ɟ֝_Mg-gAF Rgwg g;gNKMNNNlȬ(>LWpXu s2& uJIs8,49R_Mg-g8$=$ Rgwg$g2$gNKMNX֛1Ȭ(>N  w!!pXu 2&uJII8,4"Rڝ{ɟ֝_Mg-g RgwgggNKMNNNlȬ(>LWpXu s2& uJIs8,49RYMg-g## Rgwg#g#gNKMNX֛1Ȭ(>N  w!!pXu 2&uJII8,4"Rڝ{ɟ֝V^Mg-gin Rgwg5gcgNKMNNNlȬ(>LWpXu s2& uJIs8,49R^Mg-g`#e# Rgwg,#gZ#gNKMNX֛1Ȭ(>N  w!!pXu 2& uJII8,4"Rڝ{ɟ֝<Mg-g4>4> RgwgggNKMNNNlȬ(>LWpXu s2& uJIs8,49R:@e .dMg-g4>4> RgwggogNaaaNNlȬ(>^apXu s2& JI4>8,49RXMg-g   v RgwgN gp g,62/b@LK.K `ck)(e /(M+NX, R(Mg-g++ g+RgwgC+ga+g,6//b@L5.rK(//k)(  /(M>+"/3/;/XMg-gZ.. HRgwg)gyg.FFŬL$ 7...AYMg-gF MRgwg.g~g,6//A5@L5.rKfa/k)(  /(Mr"/B4^Mg-g   Rgwg g gH 1cMg-g Rgwgggj1c4bI7:CKMg-gV "Rgwggg s ~} n~Rgwg9~g}g:\~~weW~~~q4a 6: r PJSMg-g Rgwggg F͢bI<7  <^Mg-g RgwgsggjF^͢bI< ]v#V'] Rgpwgćg}guKuΈpD? /T4>4>4>4>4>4>4>GSMg-g49 Rgwg g.gc%<_?SMg-g RgwgsggRMg-gNa Rgwg*Hg;"P26"=\ֺ{8?S3۹\l8?S3ApBB?AGz?4D??he99?$@EEE50P (8PX700WP ``````ppxxxx?%SMg-gM0 hRgwg)Gg!5P26"?@FF?RMg-g nRgwgqJgp3P42PGZp[9P%P_ctBMg-g RgwgqJgp3P42Pp[%P_ct6&Mg-g3F Rgwgg-g&P26"5Mg-g RgwgqJgp3P42Pp["%FP(-0t%RPq( (a 6:@ۮ+?y`X5(?7?4BTMg-gMM UMRgwg.MgOMgNeJO=x|cO>Pfq;QQ"^3ZLeOP NZMg-gaHH -HRgwgHg'HgeJ=x|cfqmA"^aFHzUMg-gk?? 7?Rgwg?g1?gM@eJ=x|c@@f>AA"^ Z;=e@A?LWO!atV]lRn{pp^Rr[ee sstAtttE\ vπɁ݁o]hh]j?kqkll6lyl$mlmmH^pw7ouoNFnnmnpp>pWpooKcooc|Hf"PcSi} E[s U5BO\(?WAS_W#d-Pf*FKyFPZdk7   ёZpۑ"7c"###|#-$J$$$$%PVINot\V}}|}ˈwhn'|AU{^](Gn]7uotRndDqfqp oI#DjQ: ,E$̑"$%x@  -Pf*FKyvdk7   Xblpۑ:DN"7c",3"###|#-$J$$$$% INot\V|}whn'|AU{(n]u0b(oRo|(Dqfqp o4>4>4>4>4>4>4>|3E$̑"x$%4(((((n]56b(oRo|((fqp})f)*++*F(n]6b(oRo|((fqp(n]6LLMMLFr PJ`p/Us `O7B5KQk7E8+.`= ߏTe++QbH64#N-+. FFF4:LWwa5)}Nmɋ Rg׎_tg[g0m;*<<&<$*9<V<Qn2xE*E}]k<]^SVrVVMVVVWEWՈM~l{Uo^^K^Q]BPV'h^szy]tuJ`_W!XVnW>`G`M8^<9_'_oXN_.`y_KhX5[oi4*A[[nVU UDU TRg o_TgTg0m;*<<&<$*9<V<Qn2xE*E}]k<]^SVrVVMVVVWEWՈM~l{U o^^K^Q]BPoVoFo^szaXy]tuvoJ`_W!XVnWW>`G`X8^<9_'_oXN_.`y_nLWwa]QMg-gQQ RgwgQgQg0m;*<<&<$*9<V<Qn2xE*EQk<QQQQQRRRRRR;llɃ.a {RgwgTgug+uDϤ!24  RgwgzggNߥ=iMg-g_d Rgwg;gYgÑ]5poplm lRgywgzlgI!gwgg8hjhyyzzhZzh<}r}h5iMx!yy!~fi:8zOo"!=mtk1otLW!!LWDRS0©oܨ RgKwgsg{hg@z]mBkShi٢yU^ŒLWDRSgG MRgGwggsg z]mBksi٢yUTquۅSN". Zaݤ4>4>4>4>>Y4>4>qu&+KN"G"24HPؤHL/it[6%X#IeUw7?cKI0B7=k&[-+:d quK6N" "2uHPؤHDXult[6LWDRSo<æM ߥRg>wgg٥g5]mBk;i٢yU(ВӪbBt @Rg1wgg:g58mfk;iyUs͒LWDRSH̡% LWDRS   l 8Rg- wggXgzfmfuWiyUf^LWDRS  SRgwg2gMg!fk}) f!~ R"؅5,LWO!/ǸQ5h RgOwg^gg&LWX=w`$ $@$!! !Rg(wgp!gXgA"5CȐL RgKwggg7uMg-g3 ŎRgwgggLinkRich Text Format.LW3---,, ^,Rg/wg=,g7gWFE|k-Gb"LW+;%¶< RgAwgg6gWFE|k4<Mg-gKSS SRgwgRgSgS4qu4>4>4>4>N"4>4>4>4>4>AtMg-g RgwgggQu_Mg-g    Rgwgm g gVeJ=x|cfqA"^ax ewtJ nMg-ghh XhRgwg1hgRhg&ieJ=x|c}iifjBjA"^aeTi?jiƀMg-gef eRgwgegeg}feJ=x|cfgfggA"^aefgef]Mg-g:ctc cRgwgbgcgceJ=x|c+d]df1edA"^aeddc?>[Mg-gp]] <]Rgwg]g6]gI^eJ=_x|c#`"afbaA"^ ^eob[__a]w^^a(Mg-g LRgwg%gFgFeJ=x|cfqA"^eaMg-gK RgwgggIeJ=x|cHfqA"^delMg-gK RgwgggeJ=x|cfqeA"^e{pBAC@B>+?=(ԍkJ2]e"LDxxZx)y4>4>4>,$4pLFD??4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>txt0 4FIsTNTkernel32.dll%%+rMbMg-gZZ RgwgnZgZg4oAbDb3[[GbJbe``a%aMg-gaa Rgwgkagag4oaabcce``a%aonMg-gdd RgwgSdgdg4oAbdddGbJbe``a%anMg-ge e Rgwgdgeg4oAbDbejfGbJbe``a%anMg-g/h4h Rgwggg)hg4oAbDb+jjGbJbe``a%a{Mg-gbg Rgwg>g\gMg-g RgwgcggMg-gvxx BxRgwg xg==:ItY4>SnMg-g4>4> Rgwgg_`g4oAbDbPnGbJbe``a%aGetCurrentThreadSetThreadAffinityMaskGetCurrentProcessGetProcessAffinityMaskKERNEL32>quN" .'Mg-g Rgwgpgg4oAcce``a%a%Lhq%=r+r&Er+r#&Mr+r@&Jsr;%IhqX%9r+ru%Ar+r%Ir+r%PhQr7Ns+r:Rs+rLC_TIMELC_NUMERICLC_MONETARYLC_CTYPELC_COLLATELC_ALL._H:mm:ssdddd, MMMM dd, yyyyM/d/yyPMAMDecemberNovemberOctoberSeptemberAugustJulyJuneAprilMarchFebruaryJanuaryDecNovOctSepAugJulJunMayAprMarFebJanSaturdayFridayThursdayWednesdayTuesdayMondaySundaySatFriThuWedTueMonSun;=0i% #7Mg-g4>4> Rgwgg&gNKMNX֛1Ȭ(>N  w!!pXu 2& uJII8,4"Rڝ{ɟ֝YMg-g Rgwgggjј[YbImǢܧ˧lܣ;_c>YtY̅nZӅXhuZGmzZ4>4>4>4>4>4>4>4>4>4>4>4>|:s *Dw=:s *Dw=W_Mg-g5: Rgwgg/gjј[9_ibImǢܧ?*l?f_c_Mg-gZ_ Rgwg3gTgjј[_bImǢܧ˧l._cmO`Mg-g Rgwgggjј[`bImǢܧ˧l>_cm`Mg-g!& Rgwgggjј[`bIm+S˧l._caMg-g49 Rgwg g.gjј[abIm+S˧l-_caMg-g RgwgggNKMNNNlȬ(>LWpXu s2& uJIs8,49ROcMg-g&& Rgwg&g&gNaaaNNlʓȬ*>(4apX?+ Γ2& JIՓ11_1ؓ,49R_-59dMg-g88 Rgwg8g8gNabaNNl8Ȭ:>::Lcu s2& :JIݓ8:49RdMg-g] )Rgwgg#g,6//A5@L5.rKfa/k)(  /(M;r"/B_dMg-g Rgwgggj[diI mǢܧ?*$Efc }Te++:s *Dw=q nɠc|Mg-gϔ aRgwg"g[gВĒMg-g4>4> Rgwggg4>4>4>:s *Dw=:s *Dw=B?@?F8?S3۹8 4DB4C Mg-g JRgwgqJgMP42PmWFPc[At6'I?MbP?B>?HChhctrl.ocxCLSID\{ADB880A6-D8FF-11CF-9377-00AA003B7A11}\InprocServer32?w DbBADJ2:n?pBg5  ?OE9b9 Ƒ ڑ  MSChart.OCXDLLGetDocumentationDllCanUnloadNowDllGetClassObjectDllRegisterServerDllUnregisterServeriDEST:s *Dw=pcK&`/t a/t 3#fff }RgwgYgwg=dgg8hjhoez`eehehf1fh5idRdddBZnMSChartLibX}lBX}lB-&.x../:0\0001S2c4n]6l9> 4>4>4> 4>4>4>4>4>ContentsqbW3-J-Z--&.x../:0\0001S2c4j-n]-64>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>*7n]766 77O88884>4>4>4>4>4>4>CtlFrameWork_ReflectWindownn]'1e+000runtime error TLOSS error SING error DOMAIN error R6027 - not enough space for lowio initialization R6026 - not enough space for stdio initialization R6025 - pure virtual function call R6024 - not enough space for _onexit/atexit table R6019 - unable to open console device R6018 - unexpected heap error R6017 - unexpected multithread lock error R6016 - not enough space for thread data abnormal program termination R6009 - not enough space for environment R6008 - not enough space for arguments R6002 - floating point not loaded Microsoft Visual C++ Runtime Library Runtime Error! Program: ...GetLastActivePopupGetActiveWindowMessageBoxAuser32.dll1#QNAN1#INF1#IND1#SNANQgQtQQaSwTTUDQVVV0WWVSHELL32.DLLDragFinishDragQueryFileAExtractIconA3f+dyOl~}n]}6i~0(fqp4>4>4>4>4>4>4>4>4>4>4>4>\iX^fn؅4>4>4>4>4>4>4>4>4>4>4>4> %:On]R6T(fqp*?ݐ5GnP4>4>4>4>4>4>4>4>4>4>4>4>4>Ž 5܏Rj +)=sRSj +)=sRWj +)=sRn@8$6% {20 FeF$+.4n@8$6%FF44 U5qLؒB: ` V ^>;)'F FFF F+tN0 F.$4pL؅444"F!FFFϛ93c֚^O!V`ԛjn]_6>o(fqp_4>4>4>4>4>4>4>4>4>4>4>4>©ש ,eޢJ _;tǥΨr^O!ǩ]un]_6ܩ1b(fqp_4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>ˬ&Cf-B^O!V`Ьn]_6+Hk(fqp_4>4>4>4>4>4>4>4>4>4>4>ɱޱ3NծM+aϰ4y^O!V`αd|n]_68i(fqp_4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>µ޵:]س$ƴ$y^O!V`ǵn]_6 "?b(fqp_&4>4>4>4>4>4>4>4>4>4>4>4>4>YuѺ'8M{h=:^O!V`^z%=n]_6ֺ*(fqp_4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4> (=Rg̻@n)^O!V`-Bؽn]_6Wlݽ(fqp_4>4>4>4>4>4>4>4>4>4>4>4>4>4>&;Pm5Iv^O!V`+n]_6@Ur(fqp5a4>4>4>4>4>4>4>4>4>4>4> 'Ji#t7^O!#{n]_6,O(fqp_4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>Q%Yj{[P&k^O!V`Vnn]_6*[(fqp_4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>OkH0^O!V`Tp3n]_6 (fqp_4>4>4>4>4>4>4>4>4>4>4>4>4>4> ;^W^O!V`n]_6#@c(fqp_4>4>4>4>4>4>4>4>4>4>4>#8Mb(_3i^O!V` (=n]_6Rg(fqp_4>4>4>4>4>4>4>4>4>4>4>4>4>4>4> )>Sh#Bo^O!V`.Cn]_6Xm(fqp_t4>4>4>4>4>4>4>4>4>4>4>-Jm*;oKQ[i^O!V`n]_62Or(fqp_4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4> "7Tw=r^O!V`n]_6'<Y|(fqp_4>4>4>4>4>4>4>4>4>9NcxL}"S^O!V`">Sn]_6h}(fqp_4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>%Bea.b^O!V`n]_6*Gj(fqp_4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>w:rByX^O!V`|C[n]_6H(fqp_4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>-B_M^O!V`n]_62Gd(fqp_4>4>4>4>4>4>4>4>4>4>4>2G\y]^O!V`"7n]_6La~(fqp_4>4>4>4>4>4>4>4>4>h3gI^O!V`m4Ln]_69(fqp_4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>$@Uj]s%>^O!V`)EZn]_6o(fqp_4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>+Hk,^^O!V`n]_60Mp(fqp_4>4>4>4>4>4>4>4>4>4>4>4>SoFy4^O!V`Xt7n]_6$(fqp_4>4>4>4>4>4>4>4>4>4>4>1Nq2j^O!V` n]_6!6Sv(fqp_4>4>4>4>4>4>4>4>4>4>4>      / F z    u ^O!V`   ` x n]_6   4 e (fqp_4>4>4>4>4>4>4>4>4>4>4>4>2G\y 1 u    M   ^O!V`"7  n]_6La~ (fqp_4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>">Sh}lR*t^O!V`'CXn]_6m(fqp_4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>_{@r@^O!V`d+Cn]_60(fqp_4>4>4>4>4>4>4>4>4>4>4>4> 3HeCsBt^O!V`#n]_68Mj(fqp_4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>-I^s^ N^O!V`2Ncn]_6x(fqp_4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4> 5 J _ t    <^O!V` : O n]_6d y   (fqp_4>4>4>4>4>4>4>4>4>4>4>4>#*#?#T#i###!!!,"b"""^O!V`#/#D#""n]_6Y#n###"(fqp_4>4>4>4>4>4>4>4>4>4>4>4>4>V'r''''''s$$%5%%% &X&&7'^O!V`['w''"':'n]_6''''''(fqp_4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>)))))*8*((4)~)^O!V`)))i))n]_6))*=*n)(fqp_4>4>4>4>4>4>4>4>4>4>,,,,, -/-+8+{+++,u,^O!V`,,,`,x,n]_6,,-4-e,(fqp_4>4>4>4>4>4>4>4>4>4>4>4>4>/-/B/W/l///-/.r...^O!V`/2/G/..n]_6\/q///.(fqp_4>4>4>4>4>4>4>4>4>4>4>2233*3G3j3|0/112^O!V`22322n]_63/3L3o32(fqp_4>4>4>4>4>4>4>4>4>4>I=e=z=====F4~4445H5|555&6d6667\777 8Q86;t;;<z<88s99E::*=^O!V`N=j===-=n]_6=====(fqp_4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>@@@@@@"A>>i?1??@8@h@^O!V`@@@S@k@n]_6@@A'AX@(fqp_4>4>4>4>4>4>4>4>4>4>4>4>4>4>EODkDDDDDDE/EB3BhB0C@EBkEhCCC0D^O!V`TDpDDD3Dn]_6DDDD D(fqp_4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>^IHHHHHI2IfIwI@GIF G{FxGIGHGHxH^O!V`HHHcH{Hn]_6HHI7IhH(fqp_4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>W X!X6XKXhXXCKvKKKLCL:PuLLM8MjMMMN4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>t`n]_6b(oRo|((fqp_q`^O!V`b^O!V`4>4>4>4> bn]_6b(oRo|((fqp_4>Nb!Mg-gG Rgwgg gNMg-g` ,Rgwgg&gMvܵ Rgwg\gzgBɰٰPݰ5ժ4>4> Rgwggg4>4>4>4>4>4>4>P4>4>R}. Rgwgggp.P )KMg-g,f Rgwggg  G&Mg-gM0 Rgwg)GgP26"e'Mg-gM0 8Rgwg)GgP26"'Mg-gM0 |Rgwg)GgP26"/zzzz// Rgl<wga/g/g0m;*<<&<$*9<V<fh<2xE*Eihjk<qkk}Zo6j{o~~~#~ollnp<w<o{<<njmm<<22Jd333dfXg<klm0<zzzznn Rgl<wgngng0m;*<<&<$*9<V<fh<2xE*Eihjk<qkk}Zo6j{o~~~#~ollnp<w<o{~<<njmm<<@dEdJdddddfXg<klm<=5n9pt:<;pqqqWsgst(tttp;E=zzzz== Rgl<wg=g=g0m;*<<&<$*9<V<7|<2xE*EQ}k<QQ}~ ~R~~~#~R;l[@p<w<o{~<<C)~L~<<?C@V@ >C>CCzzzz AA Rgl<wg@gAg0m;*<<&<$*9<V<7|<2xE*EQ}k<QQ}~ ~R~~~#~R;lWAp<w<o{C<C)~L~<<?C@V@ >C>C Dzzzz== Rgl<wg=g=g0m;*<<&<$*9<V<7|<2xE*EQ}k<QQ}~ ~R~~~#~R;lpCp<w<o{D<C)~L~<<?C@V@HBD>C EzzzzwD|D Rgl<wgPDgqDg0m;*<<&<$*9<V<7|<2xE*EQ\Ek<QE}~ ~E~~~#~E;l~p<w<o{H<dF)~cH<<HFJzzzz5I:I Rgl<wgIg/Ig0m;*<<&<$*9<V<fh<2xE*Eihjk<qkk}Zo6j{o~~~#~ollnp<w<o{]<njmm<<JMMJdNO)OdfXg<klmjJ]QUp8W<WXpqqqWsgst(tttpY]^zzzz^^ Rgl<wg^g^g0m;*<<&<$*9<V<7|<2xE*EQ}k<QQ}5``R\a~~#~R;lacw<o{ c<_)~L~<<_`=b/c3cdzzzzcc Rgl<wg[cg|cg0m;*<<&<$*9<V<fh<2xE*Eihjk<qkk}i6j?l~~~#~lllnp<w<o{~<<jjmm<<@dEdJdddddfXg<klm%pAppp<wpqqqWsgst(tttptvzzzzvv Rgl<wgvgvg0m;*<<&<$*9<V<7|<2xE*EQ}k<QQ}vvRw~~#~w;lacw<o{ c<_)~L~<<_`yzzzzQQ Rgl<wgQgzg0m;*<<&<$*9<V<7|<2xE*EQ}k<QQ}~ ~R~~~#~R;l~p<w<o{~<<C)~L~<<:wwwxkxqxwxwwwwpjY Rgfwggg6rY %Rgwggg6NXMg-g6; Rgwgg0gy9DW^u#8Mg-g| RgwgXgvg7@jsmml/m|ll HlRgrwg$lgBlgljrrrrrrrrrr%o9onoKnn nRgrwgmgngljrrrmrrrrrnsq r~qqp q pRg5swgypgpglj9sYs]soasrrrr?qeswsa}I7~q~ ~Rgwg}g}g~tق RgwgZg{g1Ĉ? @݄ oRgwgHgigMg-g RgwgqJgP42Pmמ;FPc[At'ڞȖMg-g RgwgqJgP42PmמWFPc[At6'ڞȖLYѻMg-g C ՟RgwggϟgMg-g Rgwggg F͢bI<7   Mg-g<A Rgwgg6gF͢bI<^ #eMg-got RgwgIgig.FV͢bI<B ZMg-g Rgwggg F͢b<7  <mMg-g  RgwgqJgp3P42PIp[%P_ct6Mg-g RgwgqJgMP42PmWFPc[At6'IMg-g ǚRgwgqJgP42PmWFPc[At6'.-&.x../:0\0001S2c4 n]6> S)I  C-&.x../:0\0001S2c4 n]6l > f)I&H  lNF-&.x../:0\0001S2c4n]6l > 6 )IsE  N C*-&.x../:0\0001S2c4Fn]6la> )I Y##-&.x../:0\0001S2c4#n]6lG>  )I!" {"" 10-&.x../:0\0001S2c41n]6l )> :,)Ie-/. 9-&.x../:0\0001S2c49n]6l4> 6)I7 8 {C:-&.x../:0\0001S2c4~Cn]6lA> B)IBB QFMg-gpEE  &I)III II>Q Q-&.x../:0\0001S2c4AQn]6lM> LO)IIP 4>N%NoMg-g4>4> Rgwggog4>4>lqRqVqp]qlpqRqVqpqlpqqqqr.s;s`st.t=tu}uu9vvvuQu:wwwxkxqxwxwwwwv4>4>4>=;_.,(null)(null)@united-statesunited-kingdomunited statesunited kingdomtwnturkeyturtaiwanswitzerlandswedenswesvkspainsouth-koreasouth koreasgpsingaporerussiaprtpr-chinapr chinaportugalpolandpolnzlnznorwaynew-zealandnew zealandnetherlandsmexicomexkoreajapanitalyirlirelandicelandhungaryhong-konghong konghollandhkggreecegreat britaingrcgermanygbrfrancefinlandenglanddnkdenmarkczechnchinachecanadacanbritainbrazilbrabelgiumbelautaustriaaustraliaausamericausausukturkishtrkswissswedishsvespanish-modernspanish-mexicanspanishslovakskyrussianrusptgptbportuguese-brazilianportuguesepolishplknorwegian-nynorsknorwegian-bokmalnorwegiannornonnldnlbkoreankorjpnjapaneseitsitalian-swissitalianitaislirish-englishicelandichungarianhungreekgerman-swissgerman-austriangermanfrsfrench-swissfrench-canadianfrench-belgianfrenchfrcfrbfrafinnishfinespesnesmenzenuenienglish-usaenglish-usenglish-ukenglish-nzenglish-ireenglish-canenglish-ausenglish-americanenglishengencenaelldutch-belgiandutchdeudesdeadanishdanczechcsychtchschinese-traditionalchinese-singaporechinese-simplifiedchinese-hongkongchinesechichhcanadianbelgianaustralianamerican-englishamerican englishamericanOCPACP_yn_y1_y0frexpfmod_hypot_cabsldexpmodffabsfloorceiltancossinsqrtatan2atanacosasintanhcoshsinhlog10logpowexpTZF)QΠE>Z:ܱ Rgܿwgggsc$wFoEHK(&7u6]w:?,S3Mg-g1 Rgwggg.FF{ $ 7...yMg-gh   4 Rgwg g. g./Ŭ    O..   4>x  4>g5g5{g5mo<]hZp H $ X $ l    P     H     P      X   ( ( (  `  (  (  X   (  ( ( H  x   @  p   8  `  0   (  p    VBDataObjectVBDataObjectFilesMicrosoft Chart Unused Object'   `' p' @ P  $ $  $ 0$ @$ P$ `$ p$ MSChartMicrosoft Chart Control, version 6.0MSCHRT98.chmMSChartWndClass $  Microsoft Chart LCoor ObjectMSCHRT98.chm & $ Microsoft Chart DataPointLabel ObjectMSCHRT98.chml p&  Microsoft Chart Labels ObjectMSCHRT98.chm `&  Microsoft Chart Label ObjectMSCHRT98.chm< % ` Microsoft Chart LightSources ObjectMSCHRT98.chm %  Microsoft Chart LightSource ObjectMSCHRT98.chm  % , Microsoft Chart Light ObjectMSCHRT98.chmt &  Microsoft Chart DataPoints ObjectMSCHRT98.chm &  Microsoft Chart DataPoint ObjectMSCHRT98.chmD & h Microsoft Chart AxisTitle ObjectMSCHRT98.chm P&  Microsoft Chart StatLine ObjectMSCHRT98.chm @& 8 Microsoft Chart SeriesMarker ObjectMSCHRT98.chm| 0&  Microsoft Chart SeriesPosition ObjectMSCHRT98.chm &  Microsoft Chart SeriesCollection ObjectMSCHRT98.chm\ & | Microsoft Chart Series ObjectMSCHRT98.chm $  Microsoft Chart Rect ObjectMSCHRT98.chm$  ' H Microsoft Chart AxisScale ObjectMSCHRT98.chm '  Microsoft Chart Intersection ObjectMSCHRT98.chm 0'  Microsoft Chart ValueScale ObjectMSCHRT98.chm\ ' x Microsoft Chart Tick ObjectMSCHRT98.chm &  Microsoft Chart AxisGrid ObjectMSCHRT98.chm$ & L Microsoft Chart CategoryScale ObjectMSCHRT98.chm @'  Microsoft Chart Axis ObjectMSCHRT98.chm &  Microsoft Chart Weighting ObjectMSCHRT98.chm\  & x Microsoft Chart Wall ObjectMSCHRT98.chm &  Microsoft Chart PlotBase ObjectMSCHRT98.chm$ % D Microsoft Chart View3d ObjectMSCHRT98.chm $  Microsoft Chart Marker ObjectMSCHRT98.chm $  Microsoft Chart Pen ObjectMSCHRT98.chmT % t Microsoft Chart Location ObjectMSCHRT98.chm %  Microsoft Chart TextLayout ObjectMSCHRT98.chm$  % @ Microsoft Chart Font ObjectMSCHRT98.chm $  Microsoft Chart Coor ObjectMSCHRT98.chm 0%  Microsoft Chart Brush ObjectMSCHRT98.chmL $ l Microsoft Chart VtColor ObjectMSCHRT98.chm P%  Microsoft Chart Fill ObjectMSCHRT98.chm `% 4 Microsoft Chart Frame ObjectMSCHRT98.chm| @%  Microsoft Chart Shadow ObjectMSCHRT98.chm p%  Microsoft Chart Backdrop ObjectMSCHRT98.chmL % l Microsoft Chart DataGrid ObjectMSCHRT98.chm %  Microsoft Chart Legend ObjectMSCHRT98.chm % < Microsoft Chart Footnote ObjectMSCHRT98.chm %  Microsoft Chart Title ObjectMSCHRT98.chm P'  Microsoft Chart Plot ObjectMSCHRT98.chmp$ @ L\ VtChart Font Property PageMSCHRT98.chm@$  }9u?u VtChart SeriesColor Property PageMSCHRT98.chm0$  2 }8u>u VtChart Series Property PageMSCHRT98.chm $ P }7u=up VtChart AxisGrid Property PageMSCHRT98.chm$  }6upowS&~}}&~&~&~&~&  ?%g@@@@ @P@$@@ @4@N@ p+ŝi@]%O@qוC)@D@<զIx@oGAkU'9p|Bݎ~QCv)/&D(DJzEeǑF e uuvHMXB䧓9;5SM]=];Z] T7aZ%]g']݀nLɛ R`%u?q= ףp= ף?Zd;On?,eX?#GGŧ?@il7?3=BzՔ?aw̫?/L[Mľ?S;uD?g9Eϔ?$#⼺;1az?aUY~S|_?/D?$?9'*?}d|FU>c{#Tw=:zc%C1>?9;?&8?5?"1?r.?%L+?|'?$?$!???y??D'?wm ?ʨ???8>^>qq>/r>la>?> >o̿>|>D>ް>z7>>W >>`w>Yf>T>ocC>1>\0 >e>==~={܎=:^V==Y<?  ||7C35CA30-D112-11cf-8E72-00A0C90F26F8oleaut32.dll%ld - %s+-h/ 5 @.$ ((((( H / `y!@~ڣ @ڣ AϢ[@~QQ^ _j21~O7So! 2 N j       m ~       6 Q r      8 Y z      6 R n      2Nj.Jf*Fb~ &B^z3OkA] )Em7S{Gc8Tp4Pl0Lh,Hd (D`|$@\x2_{Hd7Rn 2 N XF; ; # VtStringList # VtListVtObject8# VtCollectionP# VtStringh# VtDataGrid # VtArray # VtMatrixP# VtDouble8# VtValue8# VtUnitsP# VtInteger8# VtChooseBrush8# VtFontUndefinedDefaultName8# VtChooseFont8# VtPict8# VtPicture# VtPictBMP# VtPictWMF8# VtInfLight38# VtLight38# VtTextFormatGeneral8# VtValueBlock8# VtTextBlock8# VtChooseTextLayout8# VtDigitSet8# VtFormatterGeneralColorAMPMAPampmap8# VtFormatGroup8# VtFill8# VtBackdrop8# VtAxis8# VtAxisPainterh VtAxisScaleBlock8# VtScaleIntervalP VtPatternPickerPP VtPenStylePickerPP VtSolidPenStylePickerPP VtPenWidthPickerPP VtValueEditP VtColorPickerPP VtBitmapOnButtonXQ VtLabeledBmpButtonPP VtComboBaseQ VtCustomComboQ VtTextComboP VtComboEditXQ VtPopupButton8# VtControlWndClassMapperR VtControl$ VtChart8# VtDataSourceBaseS VtDataSourceText8# VtChartSection VtChartText($ VtChartTitle($ VtChartFootnote8# VtSeries8# VtChSubPlot VtChartPlot8# VtChartPlotPainter8# VtChartElementxT VtBaseElementxT VtAxisElementX VtAxisLineElementX VtAxisLabelElementU VtAxisTitleElementU VtChAxisSelectionU VtChAxisLabelSelectionU VtChAxisTitleSelection`V VtChSelectManagerV VtChartItemSelection VtChartLegend8# VtChartLegendPainterU VtChartSelectionS VtChSsLink8# VtChartDataSourcepW VtChartDataSourceSeriesInRowsHT VtXLabeled2dPlotW VtBar2dPlotW VtLine2dPlotW VtArea2dPlotW VtStep2dPlotW VtCombo2dPlotW VtXLabeled3dPlotY VtBar3dPlotY VtLine3dPlotY VtArea3dPlotY VtStep3dPlotY VtCombo3dPlotHT VtPie2dPlotHT VtXYPlotU VtChSeriesSelectionU VtChBaseLabelSelectionZ VtChSeriesLabelSelectionU VtChDataPointSelectionZ VtChDataPointLabelSelection\ VtChRotateManagerU VtChPlotSelectionU VtChLegendSelectionU VtChFootnoteSelectionU VtChTitleSelection8# VtDataSource] VtDataSourceCallBack] VtDataSourceSsLink VtSeriesLabel8# VtSeriesPoint8# VtSeriesPointElement8# VtSeriesPointLabel8# VtSeriesStack8# VtSeriesStackData8# VtSurfaceDesc8# VtCBandItem_ VtCLineItemxT VtDataElement_ VtBar2dElementH` VtPolyline2dElement` VtPolygon2dElement0` VtXY2dElement VtHiLo2dElement` VtHLC2dElement(a VtHLCRight2dElement`a VtOHLC2dElement` VtOHLCBar2dElement8# VtSlice8# VtPie2D VtBar3dElement_ VtWedge3dElement VtPolyline3dElementH` VtPolygon3dElement VtMarker3dElement8# VtChartMethodc VtBar3dMethod@c VtBar2dMethodpc VtBarHorz2dMethodc VtBarHorz3dMethodpc VtBarZClust3dMethodpc VtDates2dMethodc VtLine3dMethodxd VtLine2dMethodxd VtArea3dMethodd VtArea2dMethodd VtStep3dMethod8e VtStep2dMethodd VtXYMethode FormulaOneDLLe ChartWizardDLL8# VtWindowBase8# VtWindowMapperR VtWindow8# VtMouseManager\ VtSelectManager\ VtFramingManager\ VtDragManager\ VtResizeManager8# VtSelection8# VtDynamicLinkLibraryP# VtDateTime8# VtIterator8# VtCursor # VtBtree8# VtSystemResources8# VtBitmapO VtValueAxis VtXYAxis VtPercentInterval VtLogIntervalO VtCategoryAxis,,Ee/mm/dd/yyyydddd, mmmm d, yyyy:AMPMhh:mm AM/PMhh:mm:ss AM/PM,.,/:AMPMhhhmmhhhmmss / /$()C 0z j k.~ j n.~ j 0~ j 4~ j 5CC/ .l l l l l l l l l l l H D @ < 8 4 0 (                           t l ` T P L D 0 ( m %s%s.DLL%s%s.DLL%u\%s.dll0DISPLAY""DDDDUUUU33333333f3f3f3f3333333wwwwwwwwwwwwwwwwwwUUUUDD 00003333<x<x????????~?~???????~<<f<LangRefCtlFrameWork_Parking\%ld - %sWM_DBCS_TRAILBYTE<%d><%d> %.*f -----UndefinedDefaultNameVtChart ErrorVtTxGdi2::SetDc called with non-null hdcVtChart ErrorVtTxGdi2::ReleaseDc called with null hdcVtChart ErrorVtDsGdi2::SetDc called with non-null hdcVtChart ErrorVtDsGdi2::ReleaseDc called with null hdcBMBMMMM<=>=<><=>0 pointscommdlg_SetRGBColorVCIComboPopupVCIComboPopupSCROLLBARSCROLLBAR2.00.06 VCF1FILinkVtChSsLink::Initialize SSLinkNewEx error=[%d] ()SSLinkNewExSSLinkGetDataSSLinkDeleteVCF132.OCXUseWizardDISPLAY%d%d:;Л    P @ @`w p `w hw hw hw hA     d 4     L  x y z  Е  @@ @ @@ @@@@@@@ @@@@@@@  P $ ` 0     @  u u u u u u    P ddp2@@@@@```@@@HH@HH@2ݜ#bzi F `P `^Bj5`ޠ  VCFIWZ32.DLL  fmod{(((((((  ?H d  P  <  0  (                     x t p  l  h  `  L  @  4  (                                        t  d \ X L @ 0  , (                  | x t p h d \ T  D  4  0 (          H   = = + +   7 7 ,   ) V V * * - 1 - , " f f ! !| ,t 1p ` ,X T TL @ T4 TX $, $$ b a a, b( ' ' Q Q R R 4 4  @ @  / / @ @ 0 0 _ V V _p  x At A\ *h R\ RT "P *L .D .8 )0 v, Z$ Z v , ,  ,               ( $     !                  " #| $x D0 p??_ C;?        ! 5A CPR S WY l m pr   )    pPSTPDT  ;Zx0Nm:Yw/Ml;Zx0Nm                   $0 ܬ ά F   4 $  ڞ ƛ ʞ f N ާ ʧ | p ^ H 6 &   4 (  t d V J 4 (   Н  ~ j X B 4  Ԝ Ĝ H r Z  6 & қ ޛ X f x h X H 8 (    & 4 D X d v ̨ ب   & 6 F R b r x h ğ П ܢ ̢   z l ` B 8 &  ҡ ġ 0 $ Π T B 4 $  r f Z J Щ ̣ |  l \ J 8 * (   H ~ Ҥ   D T . r h ܥ   2 F R d t ث ī ֦ P D   2 F \ p ت ƪ Ħ 8 D $ Z f N | n \ 2 " x ȥ p T T Ę Ē ĕ ( ҕ ( KERNEL32.dllUSER32.dllole32.dllADVAPI32.dllOLEAUT32.dllcomdlg32.dllGDI32.dll ܬ ά F   4 $  ڞ ƛ ʞ f N ާ ʧ | p ^ H 6 &   4 (  t d V J 4 (   Н  ~ j X B 4  Ԝ Ĝ H r Z  6 & қ ޛ X f x h X H 8 (    & 4 D X d v ̨ ب   & 6 F R b r x h ğ П ܢ ̢   z l ` B 8 &  ҡ ġ 0 $ Π T B 4 $  r f Z J Щ ̣ |  l \ J 8 * (   H ~ Ҥ   D T . r h ܥ   2 F R d t ث ī ֦ P D   2 F \ p ت ƪ Ħ 8 D $ Z f N | n \ 2 " x ȥ p hHeapAllocGetProcessHeapFreeLibrarynHeapFreenWideCharToMultiBytelstrlenW\GlobalFreefGlobalUnlock`GlobalLockMultiByteToWideCharlstrlenAlstrcpynAGetModuleFileNameAlstrcpyAlstrcatAQGetWindowsDirectoryALeaveCriticalSectionXEnterCriticalSectionLoadLibraryAGetLocaleInfoAGetProcAddress~InterlockedIncrement{InterlockedDecrementqHeapReAlloclstrcmpiAGetLastErrorLockResourceLoadResourceFindResourceALDeleteCriticalSectionQDisableThreadLibraryCallsyInitializeCriticalSectionLGetVersionGetFileAttributesAGetCommandLineAGetModuleHandleAkExitProcessFTerminateProcessGetCurrentProcessjHeapCreatelHeapDestroySetHandleCountGetFileType*GetStdHandle(GetStartupInfoAGetCPInfoGetACP GetOEMCPFreeEnvironmentStringsAGetEnvironmentStringsFreeEnvironmentStringsWGetEnvironmentStringsW{WriteFile+GetStringTypeA.GetStringTypeWLCMapStringALCMapStringWlstrcmpAUGlobalAlloccGlobalSizeIsDBCSLeadByteMGetVersionExACompareStringACompareStringWLoadStringARegisterClassArLoadCursorAFillRectDefWindowProcASetCaptureReleaseCapturePtInRectGetClientRectSetWindowPosSetWindowLongA:GetWindowLongAEnableWindowEndDialogDialogBoxIndirectParamAGetDlgCtrlIDGetParent7GetWindowGetDlgItemTextAGetDlgItemdwsprintfAReleaseDCGetDC!CharNextADestroyWindowUCreateWindowExAjIsWindowVisibleSetParentEndPaint BeginPaintSetFocusSendMessageAMoveWindowGetActiveWindow,GetSystemMetrics=GetWindowRect6ClientToScreenOffsetRectEqualRectQIntersectRectSetWindowRgn-ShowWindowCallWindowProcAGetKeyState^WinHelpA`IsDialogMessageAGetNextDlgTabItemhIsWindowEnabled]IsChildHCreateDialogIndirectParamAGetFocusGetCaptureRInvalidateRectMUnregisterClassARegisterClipboardFormatASetCursorPosGetCursorPosMapWindowPointsScreenToClient)GetSysColorGetClipboardFormatNameAPeekMessageWPostMessageWPostMessageAPeekMessageARegisterWindowMessageAECoTaskMemFreeReleaseStgMediumDCoTaskMemAlloc CoCreateInstanceVCreateOleAdviseHolderRevokeDragDropRegisterDragDrop\DoDragDrop RegDeleteValueARegCloseKeyARegSetValueExARegCreateKeyExA.RegOpenKeyExARegDeleteKeyA#RegEnumKeyExA-RegOpenKeyA5RegQueryValueA6RegQueryValueExAEDeleteMetaFileFDeleteObjectARestoreDCCDeleteDC BitBltJSelectObjectCreateCompatibleBitmapCreateCompatibleDCGetDeviceCaps@CreateSolidBrushCSaveDC<CreateRectRgnIndirectGetViewportExtExGetWindowExtExLPtoDPaSetMapModetSetViewportExtExxSetWindowExtExuSetViewportOrgExySetWindowOrgEx CreateDCAGetStockObjectGetPaletteEntriesGetDIBits7RealizePaletteKSelectPaletteGetObjectA%CreateDIBitmapCreateBitmapGetBitmapBits5CreatePaletteGetNearestColorCopyMetaFileACopyEnhMetaFileA~StretchBltiHeapCompactbGlobalReAllocIsValidLocaleIsValidCodePageIGetUserDefaultLCIDRaiseExceptionrHeapSizeSetFilePointerGetLocaleInfoW)SetStdHandleHGetTimeZoneInformationFlushFileBuffersCloseHandleSetEnvironmentVariableACharLowerBuffApLoadBitmapAMessageBoxADrawFocusRectSetClipboardDataDrawTextA?GetWindowTextA@GetWindowTextLengthA!SetWindowTextAgIsWindowFrameRectGetDesktopWindowmKillTimerSetTimeraWindowFromPointGHideCaret3ChildWindowFromPointSetCursorGetClassInfoAGetClassNameAGetCursor2GetUpdateRectQUpdateWindowGetDoubleClickTimeOleUninitializeOleFlushClipboardOleInitializeOleGetClipboardOleSetClipboardChooseColorA6CreatePatternBrush0CreateHatchBrushCreateBrushIndirect8CreatePenIndirect,CreateFontIndirectAPEnumFontFamiliesAGetKerningPairsAGetOutlineTextMetricsAGetCharABCWidthsAGetGlyphOutlineAjSetPolyFillModekSetROP2QSetBkModePSetBkColorrSetTextColorGetTextExtentPoint32AIntersectClipRectgSetPixelLineToMoveToEx:RectangleKEllipseChordArc$Pie3Polyline2Polygon.PolyPolygonTextOutApSetTextAligncSetMetaFileBitsExStretchDIBitsGetMetaFileBitsEx'PlayMetaFileOffsetViewportOrgExSSetBrushOrgExUnrealizeObject7CreatePenGetBkMode GetTextMetricsAbExtTextOutAADPtoLPGetPixelCloseMetaFile[Escape3CreateMetaFileAUpdateColors1CreateFileAGetFileSizeReadFileMulDiv5GetSystemTimeGetLocalTimeGetDialogBaseUnits5H`xH 0H5`5x5rstu v8wPxhy(#)#*#+#,#-#.#(/#@0#X1#p2#3#4#5@A0BH8u`}x}}}}}} 5k 8 P h  + ? ~  ( @ X p _ ` a0 bH ` x   ( ) * + ` a8 bP ch T U    ( $ @ % X D p   0 H ` x        8 P h     (@Xp     0H`x 8Ph|}5O(5@5 X5 h5 x5 5 5 5 5 5 5 5 5 5 5 (5 85 H5 X5 h5 x5 5 5 5 5 5 5 5 5 5 5 (5 85 H5 X5 h5 x5 5 5 5 5 5 5 5 5 5 5 (5 85 H5 X5 h5 x5 5 5 5 5 5 5 5 5 5 5 (5 85 H5 X5 h5 x5 5 5 5 5 5 5 5 5 5 5 (5 85 H5 X5 h5 x5 5 5 5 5 5 5 5 5 5 5 (5 85 H5 X5 h5 x5 5 5 5 5 5 5 5 5 5 5 (5 85 H5 X5 h5 x5 5 5 5 5 5 5 5 5 5 5 (5 85 H5 X5 h5 x5 5 5 5 5 5 5 5 5 5 5 (5 85 H5 X5 h5 x5 5 @ X 4L d l   x dl P P P\ P. |3 5 6 D8 9 t; < = 0 1 L? @ ` J  <`  , $  F8  # & 6) H L vH L@I DI zJ &( @h $N4 D P | 8 Vp Z R x HSTVpWQ$ROZQb,ce\[^^zP`<a:["d(M 0XM XN O *S T U .V lDW :\G 2\ xx^ a ~c 4f g 8(k p Ts v x ^$z | 8@} 0   | r ~ h X  TL   P  & ( , Td 0 8 T   X4 P  PH  pT 'h@+L 4 < @    Z J;;@LE6   ABOUT_BITMAPTYPELIBArialR%dItem%dC%dQ%d P&ropertiesMSChtEetwips|t point|pt|p inch|in|i|"mm|mcm|cdeg|drad|rgr|gtwipspt"mmcm d r gmmmmmmmmmmddddddddddWWWyyyyyyhhhmmmsssAM/PMA/Pam/pma/pBlackBlueCyanGreenMagentaRedWhiteYellowColorGeneralAMPMAPampmap[Red]JanuaryFebruaryMarchAprilMayJuneJulyAugust SeptemberOctoberNovemberDecemberJanFebMarAprMayJunJulAugSepOctNovDecSundayMondayTuesday WednesdayThursdayFridaySaturdaySunMonTueWedThurFriSatSundayMondayTuesday WednesdayThursdayFridaySaturdaySunMonTueWedThurFriSatSuMoTuWeThFrSa @4( @  08<<<<<< ??x??Invalid property valueProperty is read-onlyȀ1Custom ColorMS Sans Serif@&Basic colors: @@&Custom colors: @@&Define Custom Colors >>P,OKP,CancelP,&Help Pvt Pt P|(@&oP ColorP |S&olidP~ Hu&e:P| P &Sat:P P &Lum:P P~ &Red:P| P &Green:P P Bl&ue:P @&Add to Custom ColorsP MS&ystem colors:!P Ȑ(Pen WidthMS Sans SerifPWidth: P" & P]2OKP]2CancelȀCustom ColorMS Sans Serif@9?&Basic colors: @;A@9?&Custom colors: @=A@9?&Define Custom Colors >>P,OKP6,CancelPf,&Help Pvt Pt P|(@=B&oP ColorP |S&olidP0~ Hu&e:PF| P0 &Sat:PF P0 &Lum:PF Pa~ &Red:P{| Pa &Green:P{ Pa Bl&ue:P{ @;B&Add to Custom Colors(Zu|?c?c?c?c?c?c?c??@?@?c????????8803333333(Z033HfI?fI?fI?̒fI?08ۀ~VݾVV8ћoݞ8ۀnVnVnVn8ћoƶvvqƌƶvvƌƶvvvƌƶvƌƶvvqƌqƶqƌƶƌblZkbhmUUUUUUzko(( 4WU@U@U@ ( w33w( ( ( D@>MS Sans SerifPdSystem &Color:!P'd6 Pv  P  P  P  Pv  P  P  P  Pv   P   P   P   Pv.  P.  P.  P. D@nMS Sans SerifH &Property:!@$=4%P[&Font:R !P^DPh4Font St&yle:!PhH4 P(&Size: !P44 P,^%EffectsP7A Stri&keoutPCA &UnderlinePU5&Color:P_^ VCIColorComboColorPh,?Sample Pn7/ AaBbYyZzD@>MS Sans SerifP#6&Browse...P=#6&ClearPk*Preview: P]6( UUUUUfffUfUeU\eU\e\U\eUUU\fllflfffl(wwwwwUwwwwwwwUwwwwwwuUWwwwwwUUUwwwwwUUUwUUWUUWUUUUUWUUWUǪwǪwǪwwwwwwwwwwwwww(  U U U U U UU UU  UUPUUUUUUUUUUUUUUUU MSFT Q=20  d,X Lx@l4` ( T  H t<h0\$P|D p8d,X Lx@ l 4!!!`""(###T$$%%%H&&'t''<(()h))0***\++$,,,P--.|..D// 0p008112d22,333X44 555L667x77@889l994:::`;;(<RTS8O?X@0SUx^|z.P6 !`6 9@4!A040%!|CHP4!|C`h4%!$Ex !$E\ !EhX !0F !8G4~~ ! G T!! ! H<l&& ! LI T** ! I8l.. ! JhXP22 !Jh55 !KhX99 !L<< !LD$AA !P4 4UU !(RhX(D]] !R@ DT`` !T\`kk !@U(tpoo !U@ss !VXyy !WhXp !\X4 !Y !Z !@[@( !^D !_`0 ! ``|L !!4ahX0l !"ahXH !# b` !$g &x !%|o@ !&r  !'dt4$ !(8uTT !)u t!! !*w++ !+x 00 !,$yhX844 !-yP77 !.zh(== !/{8DDD !0t|T\HH !1}t|OO !2~TT !34 !4hXZZ !5h]] !6hX(aa !7t@(dd !8hXX8Hhh !9p\hkk !:T|pp !;\vv !<zz !=hX !>@4!?Lx$$0%!@ċ8 4!Aċx0H40%!B<H\04!C<`pD$%!DЍx@4!EЍ T!!@%!FtP4!Gt d''H%!H`4!I@p..<%!Jԕp4!Kԕ@  55<%!L8(4!MhP@::0%!NhX4!O l>>@%!P4!QDD4%!Rĝ4!Sĝ@ II,%!TО4!UО@MM(%!V(4!W@ RR4%!XX 4!Y@p4 WW(%!ZL 4![P ` [[L%!\t 4!]P  ccL%!^D 4!_D  0kk8%!`4   4!a4p 0  @qq%!b(H  04!c(H `  TH%!d8x ( @4!e8 @ h4%!f \ P4!g t 8%!h  `4!ix  0%!jx  p4!kx@   ,%!l8  4!mxP  0%!nh  4!o@  $ ,%!p8 8 4!q8@ H <%!r| h 4!s|@   ,%!t  4!u  8%!v(  4!w` @  L%!xX  4!y@p  0 ,%!z$ $ 4!{$  8 D %!| X 4!}  t \ <%!~  4!@  p ,%!    4!  0  l%!H  04!@`  ,%!x $ @4!` @ L%! X P4!@ p <%!0  `4!0  $%!  p4!@  <%!8  4!@ P  ,%!,h 4!,@ , <%!p D4!p \4 ""D%!D x4!D H ((D%! 4! &` <<%!(p 4!(P\@ \\$! H1X %!Xp& @ P h X8  (H 0 (  X @ P r PJɶ0 PJ4#>q d4#>q 4#>q ,4#>q a/t `/t Xᙨ2B3ᙨ2B3 ᙨ2B3ᙨ2B3ᙨ2B3L`ᙨ2B3ᙨ2B3ᙨ2B3xᙨ2B3ᙨ2B3@ᙨ2B3ᙨ2B3ᙨ2B3lᙨ2B3ᙨ2B34ᙨ2B3ᙨ2B3ᙨ2B3` ᙨ2B3 8ᙨ2B3( ᙨ2B3 ᙨ2B3 ᙨ2B3T ᙨ2B3 ᙨ2B3 ᙨ2B3 ᙨ2B3 ᙨ2B3H 0i% #7 iDEST`ᙨ2B3tᙨ2B3Hᙨ2B3<ᙨ2B3ᙨ2B3ᙨ2B3hHᙨ2B3xᙨ2B300ᙨ2B3ᙨ2B3ᙨ2B3\xᙨ2B3ᙨ2B3$ᙨ2B3ᙨ2B3ᙨ2B3PsiDESTB,1i% #7ᙨ2B3|hᙨ2B3ᙨ2B3D(ᙨ2B3ᙨ2B3 ᙨ2B3p`Yx5 58p ~sB3!~sB3"~sB3d(#~sB3UsB3,UsB3`tB30atB3XH@Z'B3PAZ'B3 B0?B3C0?B3wlluB3LwlluB3BKvB38CKvB3x7j.wB3P7j.wB3@h p tB3!p tB3 "p tB3l p#p tB3 @0xB34!0xB3!7j.wB3!h7j.wB3`"7j.wB3" 7j.wB3(#A!quB3#A!quB3# ?OB3T$X?OB3$@`+ŕB3%a+ŕB3%(lpB3%lpB3H&`@B3&0a@B3'\oPB3t'X\oPB3'@ dJ^B3<(p!dJ^B3(b_d!DEST)c_d!DESTh)PDEST) PDEST0* PDEST* PDEST* PDEST\+H PDEST+0 "QDEST$,#QDEST,$QDEST,%QDESTP-m/DEST- m/DEST. pS7b}B3|.XqS7b}B3.b=B3D/b=B3/m/DEST 0 m/DESTp0 m/DEST0 m/DEST81 `RoB318aRoB32  *DESTd2 ! *DEST2 `N+B3,3 aN+B33p nS7b}B33x oS7b}B3X4` `S7b}B34xaS7b}B3 5`dS7b}B358 eS7b}B35 fS7b}B3L6gS7b}B36hS7b}B37iS7b}B3x7jS7b}B37 kS7b}B3@8 lS7b}B38 mS7b}B39 y}#B3l9` y}#B39x [W^DST4: {7DEYT: ?;:P r PJ`; )1r PJ; 0F Fh |p| | CPf0 CPf0 d,d,Ll 4!!"#T$%%&t'<())*\+$,,-|.D/ 001d2,3345L6778l94::`;            -stdole2.tlbWWW1msdatsrc.tlbWWx]RYUYS\\\tZhJ]HWd^0LO,U\[VVV ^KH%[`VO\PLQQE\DHVtChErrorRestrictedVersionWW0InvalidPropertyValuep0GetNotSupportedW0?SetNotSupportedW`0oInvalidProcedureCall0(]InvalidObjectUseX 0WrongClipboardFormatl01/DataObjectLocked0-ExpectedAnArgumentWW0&RecursiveOleDrag 0<FormatNotByteArrayWW 0ClDataNotSetForFormatWdClearWWWd(GetDataWdüsFormatWpvDataWWd GetFormatWWW x}pbFormatSupportedWWWdrSetDataWhvValueWW5tvFormatWdwXFilesWWWGpFilesWW, zItemlIndexWWt8bstrItem, 0vCountWWWplCountW,HrAddWP jbstrFilenamevIndexWW,ϱRemoveWW,xA_NewEnum4ppUnkWWWp 0chOLEDropNoneWWWh 0+chOLEDropManualW\ 0}chOLEDropAutomaticWWX0&chOLEDragManualWXp 0*chOLEDragAutomaticWW0qUVtHorizontalAlignmentLeftWWW0VtHorizontalAlignmentRightWW0pVtHorizontalAlignmentCenterW0VtHorizontalAlignmentFillWWW0VtHorizontalAlignmentFlushWW 0bVtVerticalAlignmentTopWW 0VtVerticalAlignmentBottomWWW 0&VtVerticalAlignmentCenterWWW0whVtOrientationHorizontalWD0hVtOrientationVerticalWWW0VtOrientationUpW0VtOrientationDownWWW0VtSortTypeNoneWWH0VtSortTypeAscendingW 0VtSortTypeDescendingL0atVtAngleUnitsDegreesWL0VtAngleUnitsRadiansWL40=VtAngleUnitsGradsWWW8 0iVtPrintScaleTypeActualWW<0AVtPrintScaleTypeFittedWW 0VtPrintScaleTypeStretchedWWW0QVtPrintOrientationPortraitWWt0ZVtPrintOrientationLandscapeWx|0zVtFontStyleBoldWx0olVtFontStyleItalicWWWx0VtFontStyleOutlineWW02VtFontEffectStrikeThroughWWW0VtFontEffectUnderlineWWW@80VtBrushStyleNull@05VtBrushStyleSolidWWW@0][VtBrushStylePatternW@0~ZVtBrushStyleHatchedW0qYVtBrushPattern94PercentW0́VtBrushPattern88PercentW\0VtBrushPattern75PercentW0VtBrushPattern50PercentW0}RVtBrushPattern25PercentWx0VtBrushPatternBoldHorizontal0\VtBrushPatternBoldVerticalWWh0 VtBrushPatternBoldDownDiagonalWW 05VtBrushPatternBoldUpDiagonal0VtBrushPatternChecks0)VtBrushPatternWeaveW0(VtBrushPatternHorizontal0lVtBrushPatternVerticalWW0VtBrushPatternDownDiagonalWWX0VtBrushPatternUpDiagonal0/VtBrushPatternGridWW0%VtBrushPatternTrellisWWW0N7VtBrushPatternInvertedTrellisWWWD0-VtBrushPatternCountWX0\VtBrushHatchHorizontalWW0 VtBrushHatchVertical0ZCVtBrushHatchDownDiagonal0VtBrushHatchUpDiagonalWW0PzVtBrushHatchCrossWWW0LVtBrushHatchDiagonalCrossWWW0HVtBrushHatchCountWWWl`0#VtShadowStyleNullWWWl0VtShadowStyleDropWWW 0ScVtPenStyleNullWW,!0SVtPenStyleSolidWL 0VtPenStyleDashed`0MVtPenStyleDotted0տVtPenStyleDashDotWWW 0VtPenStyleDashDotDot<0yVtPenStyleDitted0VtPenStyleDashDitWWW0(VtPenStyleDashDitDit0VtPenStyleNative4!0MVtPenJoinMiterWW40\VtPenJoinRoundWW40-?VtPenJoinBevelWW 0VtPenCapButt| 0yVtPenCapRoundWWW0VtPenCapSquareWW!0}VtFrameStyleNull0GVtFrameStyleSingleLineWW40VtFrameStyleDoubleLineWWl0b:VtFrameStyleThickInnerWW0-VtFrameStyleThickOuterWW` 01VtPictureTypeNullWWW` T"0McVtPictureTypeBitmapW` @0 VtPictureTypeVectorW`  0 MVtPictureTypeBMP` "0VtPictureTypeWMF \#0bWVtPictureOptionNoSizeHeaderW l07VtPictureOptionTextAsCurvesW( 80VtPictureMapTypeActualWW( #0"`VtPictureMapTypeFittedWW( 0VtPictureMapTypeStretchedWWW( 02VtPictureMapTypeTiledWWW( 0QnVtPictureMapTypeCropFittedWW(  0SVtPictureMapTypeHorizontalTileWW( 0uVtPictureMapTypeVerticalTile 0VtGradientStyleHorizontalWWW 0VtGradientStyleVerticalW l0IVtGradientStyleRectangle 0VtGradientStyleOvalW 06VtFillStyleNullW <$0VtFillStyleBrush 0k3VtFillStyleGradientWT 0gVtMarkerStyleDashWWWT d!0EVtMarkerStylePlusWWWT 0TVtMarkerStyleXWWT D0`VtMarkerStyleStarWWWT #01qVtMarkerStyleCircleWT 0IJVtMarkerStyleSquareWT !0 VtMarkerStyleDiamondT H0VtDcTypeDisplayW 0VtDcTypePrinterW H!0S+VtDcTypeMetafile !0VtTextOutputTypeHardware 0FVtTextOutputTypePolygonWH ()0*VtTextLengthTypeVirtualWH "0tVtTextLengthTypeDeviceWW h0VtChChartType3dBarWW 00VtChChartType2dBarWW (+0LVtChChartType3dLineW 0VtChChartType2dLineW &0VtChChartType3dAreaW 0VtChChartType2dAreaW "0VtChChartType3dStepW $0VtChChartType2dStepW '0VtChChartType3dCombinationWW 0sVtChChartType2dCombinationWW 0DVtChChartType3dHorizontalBar @ 0@VtChChartType2dHorizontalBar d$0VtChChartType3dClusteredBarW @*0VtChChartType3dPieWW &0|VtChChartType2dPieWW D0VtChChartType3dDoughnutW 0VtChChartType2dXYWWW H&0VtChChartType2dPolar |0VtChChartType2dRadar 03PVtChChartType2dBubbleWWW 0VtChChartType2dHiLoW 0VtChChartType2dGantt #0 'VtChChartType3dGantt *0*9VtChChartType3dSurfaceWW ` 0VtChChartType2dContourWW t)0%VtChChartType3dScatterWW 0,;VtChChartType3dXYZWW T08VtChChartTypeCountWW *0ءVtChSeriesTypeVaries)0BVtChSeriesTypeDefaultWWWT-0bVtChSeriesType3dBarWx*0UKVtChSeriesType2dBarW0VtChSeriesType3dHorizontalBarWWW,0ŶVtChSeriesType2dHorizontalBarWWW*0bVtChSeriesType3dClusteredBar0)VtChSeriesType3dLine0,0sVtChSeriesType2dLine 0r\VtChSeriesType3dArea!0EVtChSeriesType2dArea$0KMVtChSeriesType3dStep 06VtChSeriesType2dStep0VtChSeriesType2dXYWWX0VtChSeriesType2dPolarWWW'00VtChSeriesType2dRadarLineWWW 09VtChSeriesType2dRadarAreaWWW(0VtChSeriesType2dBubbleWWT0|~VtChSeriesType2dHiLo/0lVtChSeriesType2dHLCW"0AVtChSeriesType2dHLCRightP(0VtChSeriesType2dOHLCx0VtChSeriesType2dOHLCBarW0 VtChSeriesType2dGanttWWW.08TVtChSeriesType3dGanttWWW 0)VtChSeriesType3dPieW0NVtChSeriesType2dPieWt-0=VtChSeriesType3dDoughnut,0tVtChSeriesType2dDatesWWW0_VtChSeriesType3dBarHiLoW/0VtChSeriesType2dBarHiLoW/!0)QVtChSeriesType3dHorizontalBarHiLoWWW(!01VtChSeriesType2dHorizontalBarHiLoWWW8# 05VtChSeriesType3dClusteredBarHiLo+0YVtChSeriesType3dSurfaceW0vWVtChSeriesType2dContourW`30UVtChSeriesType3dXYZW10VtChSeriesTypeCountWt0]VtChPartTypeChartWWWt10VtChPartTypeTitleWWWt)0GVtChPartTypeFootnotet.08VtChPartTypeLegendWWt.0 VtChPartTypePlott.0*jVtChPartTypeSeriesWWt\*0S VtChPartTypeSeriesLabelWt0VtChPartTypePointWWWt0?VtChPartTypePointLabelWWtP)0VtChPartTypeAxist0VtChPartTypeAxisLabelWWWtt/0VtChPartTypeAxisTitleWWWtd&0qVtChPartTypeSeriesNameWWt50&VtChPartTypePointNameWWWtP20NyVtChPartTypeCountWWW0pVtChLocationTypeTopLeftWh00oVtChLocationTypeTopW0VtChLocationTypeTopRight0VtChLocationTypeLeft0VtChLocationTypeRightWWW50?YVtChLocationTypeBottomLeftWW60~PVtChLocationTypeBottomWW0VtChLocationTypeBottomRightW20 VtChLocationTypeCustomWW<\0GOVtChLabelComponentValueW<H00KVtChLabelComponentPercentWWW<H/0tVtChLabelComponentSeriesName<30)ZVtChLabelComponentPointNameW030!VtChLabelLineStyleNoneWWH+0VtChLabelLineStyleStraightWW'0VtChLabelLineStyleBentWW60dVtChLabelLocationTypeNoneWWW 0VtChLabelLocationTypeAbovePointW$0 :VtChLabelLocationTypeBelowPointW#0MVtChLabelLocationTypeCenterW-0VtChLabelLocationTypeBaseWWW20YVtChLabelLocationTypeInsideW<.0VtChLabelLocationTypeOutside40VtChLabelLocationTypeLeftWWW+0wVtChLabelLocationTypeRightWWh3 0YdVtChSubPlotLabelLocationTypeNoneh6!0XVtChSubPlotLabelLocationTypeAboveWWWh$7!0*VtChSubPlotLabelLocationTypeBelowWWWh"0VVtChSubPlotLabelLocationTypeCenterWW-0 VtChPieWeightBasisNoneWW 0VtChPieWeightBasisTotalW803#VtChPieWeightBasisSeries060VtChPieWeightStyleAreaWW0'0tVtChPieWeightStyleDiameterWW' 0ɊVtChAxisIdXW* 0ƊVtChAxisIdYW( 0JVtChAxisIdY2l7 0ˊVtChAxisIdZW8"03VtChAxisIdNoneWW30AVtChDateIntervalTypeNone$0VtChDateIntervalTypeDailyWWW.0XVtChDateIntervalTypeWeeklyWWD0uVtChDateIntervalTypeSemimonthlyW"0VtChDateIntervalTypeMonthlyW< 0ZVtChDateIntervalTypeYearlyWW\<0qVtChScaleTypeLinearW\@'0 VtChScaleTypeLogarithmic\|<0SVtChScaleTypePercent$90rVtChPercentAxisBasisMaxChart(/0VtChPercentAxisBasisMaxRowWWP:0VSVtChPercentAxisBasisMaxColumnWWW0IVtChPercentAxisBasisSumChart$0gVtChPercentAxisBasisSumRowWW0=0VtChPercentAxisBasisSumColumnWWW$,0$ VtChAxisTickStyleNoneWWW$850VtChAxisTickStyleCenterW$$(0VtChAxisTickStyleInsideW$0VtChAxisTickStyleOutside80L]VtChStatsMinimum0ZVtChStatsMaximum(6 08VtChStatsMeanWWW00VtChStatsStddevW>0VtChStatsRegressionW 0%VtChNoDisplayWWWp"0VtChDisplayPlotW10VtChLayoutPlotWW/08VtChDisplayLegendWWW$*0P VtChLayoutLegend 20:VtChLayoutSeries<0Z?VtChPositionSectionWP-0 :VtChMouseFlagShiftKeyDownWWWP?0ZVtChMouseFlagControlKeyDownW020VtChSsLinkModeOffWWWl>0VtChSsLinkModeOnT50VtChSsLinkModeAutoParseW40VVtChDrawModeDraw|80VtChDrawModeBlit|50VtChContourColorTypeAutomaticWWW|=0VtChContourColorTypeGradient|X?0{VtChContourColorTypeManualWW,0VtChContourDisplayTypeCBands0.VtChContourDisplayTypeCLinesD40VtChSurfaceBaseTypePedestalWDP;0ƌVtChSurfaceBaseTypeStandardWD0%0VtChSurfaceBaseTypeStandardWithCBandsWWWD?%0dVtChSurfaceBaseTypeStandardWithCLinesWWW-0^VtChSurfaceDisplayTypeNoneWW?0wVtChSurfaceDisplayTypeCBands@0kXVtChSurfaceDisplayTypeCLines@10|]VtChSurfaceDisplayTypeSolidW0%0VtChSurfaceDisplayTypeSolidWithCLinesWWW 90~VtChSurfaceProjectionTypeNoneWWW  0{vVtChSurfaceProjectionTypeCBandsW h+0WVtChSurfaceProjectionTypeCLinesWpT40C\VtChSurfaceWireframeTypeNonep@0,VtChSurfaceWireframeTypeMajorWWWp<%0XVtChSurfaceWireframeTypeMajorAndMinorWWW(00ȲMaxW(ARedW<@GreenWWWABlueF n$AutomaticWWWx5pStyleWWW8M&JoinGF}CapW :hNWidthWWW3LimitWWW,&VisibleW(GSize$> >FillColorWWWLG OHorzAlignmentWWWL VertAlignmentWWWL? wOrientationWL7WordWrapH7 GLocationTypeX,Name>|EffectWWB 9PatternColor<IndexWWWl tGOffsetWW!? WFrameColorWW!xH SpaceColorWW#="_TextWWW#8 Text#l6 2TextLengthWW#=UFont#8SelectWW%> $ColumnCountW%6qColumnLabelCount%E RowLabelCountWWW%(<uRowCount%44 DeleteColumnsWWW:)iColumnWW%@ InsertColumnsWWW%: DeleteColumnLabelsWW; &LabelIndexWW%t?bInsertColumnLabelsWW%; DeleteRowsWW:`.RowW%+ InsertRowsWW%PADeleteRowLabelsW%CCInsertRowLabelsW%#RandomDataFillWW%9Y3SetSizeWF DataRowCount ?]DataColumnCountW%\InitializeLabels%GuRandomFillColumnsWWW%lRandomFillRowsWW%(RMoveData35TopW{LeftFH{BottomWW8 RightWWW> ̉OverOffsetWW0J bDownOffsetWW nullFlag%K LColumnLabelW%:#6CompositeColumnLabel%0FyCompositeRowLabelWWW%XB^RowLabel&t4 B_IntensityWW&$I UmIntensityWWW&HqZWWWp2ppEnumWWt'I _ItemWWW<(KUAmbientIntensity<(d +EdgeIntensityWWW<(H mEdgeVisibleW)KeRotation)I ,ElevationWWW)= kBaseHeightWW*X=V BasisWWW$,1gExcluded$,4]HiddenWW$,7AOrderWWW$,  ϾStackOrderWW,FTAuto,;Show-AFlag7L9type|.4-7#FormatWW|.xJTStanding|.J FormatLength 0,K7CustomWW 0F "ComponentWWW 0L wLineStyleWWW 0xA .ValueFormatW 0H PercentFormatWWW 0IuResetCustomLabel0HיEdgePenW0 0ResetCustomWd2E 1_LegendTextWd2N SecondaryAxisWWWd24I SeriesTypeWWd2> GuideLinePend2ShowLined2NPositiond20M mLegendTextWWd2`' `ShowGuideLineWWWL6FaxisIDWWd2`ITypeByChartTypeW:hK ?chartTypeWWW4MVnDivisionsPerLabelWWW4GDivisionsPerTick4`1 sULabelTickWWW5|(MinorPen5MgMajorPenL6MPointWWWL6OmLabelsInsidePlot7JYLengthWW7N9zHide7PJ˪LogBaseW7C _PercentBasis8OMinimumW8A MaximumW8B |MajorDivisionWWW8Retrieves data of a specified format from a DataObject object.EAdds a supported format and possibly its data to a DataObject object.W7A collection of filenames used by the vbCFFiles format.WWWnReturns a specific filename by index from the Files collection of a DataObject object (vbCFFiles format only).gReturns the number of filenames in the Files collection of a DataObject object (vbCFFiles format only).WWWWAdds a filename to the Files collection of a DataObject object (vbCFFiles format only).WWWcClears all filenames stored in the Files collection of a DataObject object (vbCFFiles format only).WWW\Removes a filename from the Files collection of a DataObject object (vbCFFiles format only).WW$Accepts no OLE drag/drop operations.WW9Accepts an OLE drag/drop under programmatic control only.W6Accepts an OLE drag/drop without programmatic control.BOLE drag/drop will be initialized only under programmatic control.jOLE drag/drop will be initialized when the user drags 'out' of the control, or under programmatic control.Horizontal leftWWWHorizontal rightWWHorizontal centerWFillWWFlushW Vertical topWWVertical bottomWWWVertical centerWWWHorizontal textWWW Vertical textWUp oriented textWWDown oriented textSort Type - NoneWWSort Type - AscendingWSort Type - DescendingDegree Angle UnitsRadian Angle UnitsGrad Angle UnitsWWPrint Scale Type - ActualWPrint Scale Type - FittedWPrint Scale Type - StretchedWWPrint Orientation - PortraitWWPrint Orientation - LandscapeWBoldWWItalicOutlineWWWStrike Through UnderlineW"No brush(background shows through)Solid VtColor brushWWWBitmap patterned brush Hatched brushW94 percent pattern colorWW88 percent pattern colorWW75 percent pattern colorWW50 percent pattern colorWW25 percent pattern colorWWBold Horizontal LinesWBold Vertical LinesWWWBold Down Diagonal LinesWWBold Up Diagonal LinesChecks pattern Weave patternWHorizontal LinesWWVertical Lines Down DiagonalW Up DiagonalWWW Grid PatternWWTrellis PatternWWWInverted Trellis PatternWW&Number of elements in this enumerationHorizontal Hatch LinesVertical Hatch LinesWWDown Diagonal Hatch LinesWUp Diagonal Hatch LinesWWWCross Hatch LinesWDiagonal Cross Hatch Lines No shadowW Drop shadowWWWNull penWW Solid penW Dashed pen Dotted pen Dash-dot penWWDash-dot-dot penWWDitted line penWWW Dash-dit penWWDash-dit-dit penWWMitered pen joinWWRound pen joinBeveled pen joinWW Butt pen capWW Round pen capWSquare pen capNo frameWW$A Single line encloses the backdrop.WW+Two equal width lines enclose the backdrop.WWW>A thick inner line and a thin outer line enclose the backdrop.>A thin inner line and a thick outer line enclose the backdrop. No graphic.WWWWindows bitmap.WWWMicrosoft Windows Metafile.WWWOmit Adobe placeable header.WWReplace text with polygons.WWW9Displays the graphic at the original size it was created.W;Scales the graphic proportionally to fit within the object.WWWMScales the graphic to fill the object regardless of its original proportions.W5Duplicates the graphic repeatedly to fill the object.WDCenters the graphic and scales it proportionally to fill the object.WWTiles the graphic horizontally.WWWTiles the graphic vertically.W'The VtColor changes from top to bottom.WWW'The VtColor changes from left to right.WWWFThe VtColor changes in concentric rectangles from the center outwards.AThe VtColor changes in concentric ovals from the center outwards.W#No fill. (background shows through)WWW A solid VtColor or pattern fill.WWA gradient fill.WW Dash markerWWW Plus markerWWWX markerWW Star markerWWW Circle markerW Square markerWDiamond markerTriangle markerWWWDown triangle markerWWFilled circle markerWWFilled square markerWWFilled diamond markerWFilled up triangle markerWFilled down triangle markerWWW3D BallWWW No MarkerWPerspective projection"2.5 dimensional oblique projection%Orthogonal projection(no perspective)WFrontal projectionOverhead projectionWWW No smoothingWWQuadratic BSpline smoothingWWWCubic BSpline smoothingWWWDevice context type NullWWDevice context type DisplayWWWDevice context type PrinterWWWDevice context type MetafileWWTT virtual text length#Actual length used by output deviceWWW3d Bar2d Bar3d LineWWW2d LineWWW3d AreaWWW2d AreaWWW3d StepWWW2d StepWWW3d Combination2d Combination3d Horizontal BarW2d Horizontal BarW3d Clustered BarWW3d Pie2d Pie 3d DoughnutWWW2d XYW2d PolarWW2d RadarWW 2d BubbleW2d HiLoWWW2d GanttWW3d GanttWW 3d Surface 2d Contour 3d Scatter3d XYZ$Used by UI to describe combo charts.WWDefaultWWW 2d Radar LineW 2d Radar AreaW 2d HiLoCloseWW 2d HLC RightWW2d OHLCWWW 2d OHLC BarWWW2d DatesWW 3d Bar HiLoWWW 2d Bar HiLoWWW3d Horizontal Bar HiLo2d Horizontal Bar HiLo3d Clustered Bar HiLoWPart type - chartWPart type - titleWPart type - footnoteWWPart type - legendPart type - plotWWPart type - seriesPart type - series labelWWPart type - pointWPart type - point labelWWWPart type - axisWWPart type - axislabelWPart type - axistitleWPart type - series nameWWWPart type - point nameTop leftWWTopWWW Top rightWLeftWWRightW Bottom leftWWWBottom Bottom rightWWCustom1The value of the data point appears in the label.WgThe value of the data point is displayed in the label as a percentage of the total value of the series.WWW0The series name is used to label the data point.WW4The data point name is used to label the data point.WWLabel Line Style - NoneWWWLabel Line Style - StraightWWWLabel Line Style - BentWWWLabel Location - NoneWLabel Location - AbovePointWWWLabel Location - BelowPointWWWLabel Location - CenterWWWLabel Location - BaseW'Label Location - Inside pie or doughnutWWW(Label Location - Outside pie or doughnutWWLabel Location - LeftWLabel Location - RightLocation Type - NoneWWLocation Type - AboveWLocation Type - BelowWLocation Type - CenterPie Weight Basis - NoneWWWPie Weight Basis - TotalWWPie Weight Basis - SeriesWPie Weight Style - AreaWWWPie Weight Style - DiameterWWWX AxisY AxisY2 AxisWWWZ AxisNo AxisWWWDate Interval Type - NoneWDate Interval Type - DailyDate Interval Type - WeeklyWWW Date Interval Type - SemimonthlyWWDate Interval Type - MonthlyWWDate Interval Type - YearlyWWWScale Type - LinearWWWScale Type - LogarithmicWWScale Type - PercentWWPercent Axis Basis - MaxChartWPercent Axis Basis - MaxRowWWWPercent Axis Basis - MaxColumn Percent Axis Basis - MaxSumChartWWPercent Axis Basis - MaxSumRow!Percent Axis Basis - MaxSumColumnWAxis Tick Style - NoneAxis Tick Style - CenterWWAxis Tick Style - InsideWWAxis Tick Style - OutsideW&Shows the minimum value in the series.&Shows the maximum value in the series.8Shows the mathematical mean of the values in the series.WW9Shows the standard deviation of the values in the series.W7Shows a trend line indicated by the values in a series.WWWNo effect on chart appearance.Update plot display.WWUpdate plot layout.WWWUpdate legend display.Update legend layout.WUpdate series layout.WUpdate section position.WWShift key downControl key downWWOffWWWOnWWWW Auto Parse$Draws directly to the display deviceWW0Blits an offscreen drawing to the display deviceWWContour VtColor - AutomaticWWWContour VtColor - GradientContour VtColor - ManualWWContour Display - CBandsWWContour Display - CLinesWWSurface Base - PedestalWWWSurface Base - StandardWWW!Surface Base - StandardWithCBandsW!Surface Base - StandardWithCLinesWSurface Display - NoneSurface Display - CBandsWWSurface Display - CLinesWWSurface Display - SolidWWW!Surface Display - SolidWithCLinesWSurface Projection - NoneWSurface Projection - CBandsWWWSurface Projection - CLinesWWWSurface Wireframe - NoneWWSurface Wireframe - MajorW!Surface Wireframe - MajorAndMinorW No border.Fixed single line border.WDefault chart pointer.Arrow pointer.Crosshair pointer.I beam pointer.WWW Icon pointer.W Size pointer.WSize NE SW pointer.WWWSize N S pointer.WSize NW SE pointer.WWWSize WE pointer.WWUp arrow pointer.WHourglass (wait) pointer.WNo drop pointer.WWArrow and hourglass pointer.WW Arrow and question mark pointer.WWSize all pointer.W Y coordinateWW"Sets the x and y coordinate values X coordinateWWMinimum Coor objectWWWMaximum Coor objectWWW Red valueW Green valueWWW Blue valueAutomatic VtColor selectionWWWSet red, green, and blue valuesWWWThe type of lineWW$Defines how line segments are joinedWW Defines how line ends are cappedWW!The VtColor used to draw the lineW)Defines the width, in points, of the lineW7Defines the joint limit as a multiple of the line widthWWWDetermines if marker is visibleWWWThe type of marker#The pen used to draw marker outlineWWWSize of the marker in pointsWWVtColor used to fill the markerWWW$Defines horizontal alignment of textWW"Defines vertical alignment of textDefines orientation of textWWWText Word WrapDetermines if text is visibleW#Determines the position of the textWWWThe name of the VtFontSize of the VtFont in pointsWWDefines styles of the VtFontWWDefines effects of the VtFontWVtFont VtColor objectWDefines the style of the brushFill VtColor objectWWWPattern VtColor object!Defines the pattern for the brushW<Determines whether this shadow object's parent has a shadow.WW5Returns the Brush object associated with this shadow.W`Returns the Coor object that describes the distance the shadow is offset from its parent object.WWThe type of fill.WABrush object that describes the brush used in a brush style fill.WThe type of frameWThe VtColor of the frameWW'The VtColor of the space between framesWWW"The width, in points, of the frameText Layout objectReturns/sets the title textWWW%Returns the length of the title text.WStdFont Object (write-only)WWWSelects the chart title.WWReturns/sets the footnote text(Returns the length of the footnote text.WWSelects the chart footnote.WWWSelects the chart legend.W9Returns/sets the number of data columns in the data grid.WMReturns/sets the number of levels of labels on data columns in the data grid.WJReturns/sets the number of levels of labels on data rows in the data grid.6Returns/sets the number of data rows in the data grid.GDeletes columns of data and their associated labels from the data grid.WWW/Adds one or more data columns to the data grid.WWW>Deletes levels of labels from the data columns in a data grid.GAdds one or more levels of labels to the data columns in the data grid.WWWDDeletes rows of data and their associated labels from the data grid.WW,Adds one or more data rows to the data grid.WW;Deletes levels of labels from the data rows in a data grid.WWWDAdds one or more levels of labels to the data rows in the data grid.WW1Fills the data grid with randomly generated data.W4Sets the number and levels of data columns and rows.WWNAssigns each label in the first level of data grid labels a unique identifier.HFills one or more columns of the data grid with randomly generated data.WWEFills one or more rows of the data grid with randomly generated data.W(Moves a block of cells on the data grid.WW#Gets the value of a data grid cell.WWW#Sets the value of a data grid cell.WWW9Returns/sets the label on a data column in the data grid.WHReturns the multi-level label that identifies a column in the data grid.WWEReturns the multi-level label that identifies a row in the data grid.W6Returns/sets the label on a data row in the data grid.EReturns/sets the strength of the light coming from the light source.WCReturns/sets the X coordinate for the location of the LightSource.WWWCReturns/sets the Y coordinate for the location of the LightSource.WWWCReturns/sets the Z coordinate for the location of the LightSource.WWW]Sets the X,Y,Z coordinates for the LightSource location and the intensity of the LightSource.WNumber of items in a collectionWWW(Add a new LightSource to the collection.WW)Remove a LightSource from the collection.W9Returns a specific item from the LightSources collection.WEReturns/sets the percentage of ambient light illuminating a 3D chart.WCReturns/sets the intensity used to display the edges on a 3D chart.WWWEDetermines whether edges are displayed on the elements in a 3D chart.WA collection of light sources.CReturns/sets the degree of rotation from which the chart is viewed.WWWDReturns/sets the degree of elevation from which the chart is viewed.WW:Sets the rotation and elevation used to display the chart.4Returns/sets the height of the chart base in points.WW8Returns the brush object associated with the chart base.WW4Returns the pen object associated with the pen base.WWJReturns/sets the type of weighting used to determine pie or doughnut size./Determines how the weighting factor is applied.WWWhSets the size of each 2D or 3D pie or doughnut in relation to other pies or doughnuts in the same chart.WWAReturns/sets the thickness of the walls of a 3D chart, in points.W8Returns the Brush object associated with the chart wall.WW6Returns the Pen object associated with the chart wall.7Determines whether a series is excluded from the chart.WWWCDetermines whether a series is hidden (not displayed) on the chart.WWW5Returns/sets the position of the series in the chart.W^Returns/sets position in which the current series is drawn if it is stacked with other series.kDetermines whether to automatically assign the next available marker type to all data points in the series.WWW7Determines whether markers are displayed for the seriesWWWBDetermines which statistic lines are being displayed for a series.3Returns the VtColor object for this statistic line.WWW=Returns/sets the thickness of the statistics line, in points.W>Returns/sets the line type used to display the statistic line.7Returns the Backdrop object associated with this label.WWW2Returns/sets the format used to display the label.:Returns/sets the VtFont object associated with this label.ZDetermines whether to automatically rotate the label if it would improve the chart layout.Determines whether axis labels are displayed laying down in the X or Z plane or rotated up on the text baseline to stand in the Y plane.WW9Returns the TextLayout object associated with this label.W(Returns the length of the format string.WW"Returns one item from a collection"Returns/sets the point label text.BReturns the Backdrop object associated with this data point label.@Returns the VtFont object associated with this data point label.WWwReturns the LCoor object which describes the offset of the data point label from one of the predefined label positions.WWWDReturns the TextLayout object associated with this data point label.WW=Returns/sets the standard position used to display the label.W?Determines whether custom text is used to label the data point.WWW@Returns/sets the type of label to be used to identify the point.WWaReturns/sets the type of line used to connect a pie slice to a label displayed outside the slice.W=Returns/sets the format used to display the label as a value.W?Returns/sets the format used to display the label as a percent.WWW0Returns the length of the data point label text.WWPResets any custom attributes placed on a data point label to the series default.WWSelects a data point label.WWWBReturns the DataPointLabel object associated with this data point.9Returns the Brush object associated with this data point.W?Returns the Pen object used to draw the edge of the data point.WWW:Returns the Marker object associated with this data point.fReturns/sets how far the pie slice representing this data point is offset or pulled away from the pie.JResets any custom attributes placed on a data point to the series default.!Selects an individual data point.W?Determines whether a series is charted on the secondary Y axis.WWWLReturns/sets the series type being used to display this series in the chart.WW>Returns the Pen object associated with this series guidelines.4Determines whether a line is displayed for a series.WW3Returns the Pen object associated with this series.WWW8Returns the Position object associated with this series.WW<Returns the SeriesMarker object associated with this series.WW8Returns the StatLine object associated with this series.WW4Retruns the collection of datapoints in this series.WWCSets or returns the text that identifies this series in the legend.WWWSelects a chart series.WWW=Determines whether the guidelines are displayed for a series.WRReturns the series type used to draw the series if chart type is set to ChartType.,Returns/sets the text used as an axis title.WW<Returns the Backdrop object associated with this axis title.WW:Returns the VtFont object associated with this axis title.-Determines whether the axis title is visible.W>Returns the TextLayout object associated with this axis title.%Returns the length of the axis title.W4Determines whether the axis is automatically scaled.WW;Returns/sets how many divisions are skipped between labels.WWW?Returns/sets how many divisions are skipped between tick marks.WWWODetermines where category axis labels are positioned relative to the axis tick.WWW>Returns the Pen object used to draw the minor axis grid lines.>Returns the Pen object used to draw the major axis grid lines.JDetermines whether the chart uses the value of Point to position the axis.LReturns/sets where the current axis intersects the axis perpendicular to it.WWIdentifies a specific axis.WWWReserved for future use.WW%Axis labels are adjacent to the axis.W?Returns/sets the length of axis tick marks, measured in points.WWW+Returns/sets the position of the axis tick.WWW&Determines whether the axis is hidden.$Returns/sets the type of axis scale.WWPReturns/sets the logarithm base used to plot chart values on a logarithmic axis.WWPReturns/sets the type of percentage used to plot chart values on a percent axis.WW>Determines whether automatic scaling is used to draw the axis.BReturns/sets the lowest or beginning value used to scale the axis.@Returns/sets the highest or ending value used to scale the axis.WWAReturns/sets the number of major divisions displayed on the axis.W\Returns/sets the number of minor divisions displayed within each major division of the axis.WWBReturns the Pen object used to draw the axis lines and tick marks.8Returns the number of levels of labels for a given axis.WW;Returns the CategoryScale object associated with this axis.WWW6Returns the AxisGrid object associated with this axis.:Returns the Intersection object associated with this axis.2Returns the Tick object associated with this axis.3Returns the Scale object associated with this axis.WWW8Returns the ValueScale object associated with this axis.WW7Returns the AxisTitle object associated with this axis.WWWA group of chart axis labels.W;Returns/sets the unit of measure used for all chart angles.WWWUDetermines whether pie charts are drawn in a clockwise or counterclockwise direction.WJReturns/sets the order in which the slices of a pie or doughnut are drawn.;Returns the Backdrop object associated with the chart plot.WWW8Returns/sets the starting angle used to draw pie charts.WWWReturns/sets the position used to display a label on each pie or doughnut in the chart.WWW8Returns/sets the spacing of 2D and 3D bars in the chart.WW3Returns/sets the x spacing of 3D bars in the chart.WWW8Determines whether the plot is in automatic layout mode.WWNReturns/sets the percentage of the chart height to be used as the chart width.NReturns/sets the percentage of the chart height to be used as the chart depth.SReturns the Rect object which indicates the position of the plot area of the chart.WWWRReturns/sets the projection type used to display a 3D chart on a 2D output device.3Returns/sets the z spacing of 3D bars in the chart.WWW`Returns the View3d object which indicates the rotation and elevation used to display a 3D chart.WW<Returns the PlotBase object associated with this chart plot.WW=Returns the Weighting object associated with this chart plot.W8Returns the Wall object associated with this chart plot.WWSeries CollectionW\Indicates whether series data is being read from a row rather than a column in a data grid.WW&The light source illuminating a chart.PReturns/sets the type of percentage used to plot chart values in a percent axis.WWQSpecifies whether or not the unit scale for all value axes in a chart is uniform.W8Returns the Axis object associated with this chart plot.WWDetermines whether the current data point row and column is automatically incremented after the Data property is used to enter or update data in the data grid.WWW=Determines whether random data is used to generate the chart.WFReturns/sets the type of chart used to plot the data in the data grid.0Returns/sets the active column in the data grid.WW4Returns/sets the number of columns in the data grid.WWTReturns/sets the label associated with the column identified by the Column property.WWTReturns/sets the number of levels of labels above the data columns in the data grid.WW/Identifies a particular level of column labels.WWW^Returns/sets the value of a specific data point in the data grid identified by Column and Row./Returns/sets the text used as a chart footnote.WWWJDetermines whether the chart repaints after a change is made to the chart.-Returns/sets the active row of the data grid.W1Returns/sets the number of rows in the data grid.WNReturns/sets the label associated with the row identified by the Row property.YReturns/sets the number of levels of labels to the left of the data rows in the data gridW,Identifies a particular level of row labels.WWNReturns/sets the column of the chart in which the current series is displayed.YReturns/sets the chart type used to display the series identified in the Column property.W8Determines whether the legend is displayed on the chart.WW/Determines when and how the chart is repainted.WWW/Returns or sets the border style for the chart.WWW'Returns the window handle of the chart.WWW3Returns the Title object associated with the chart.WWW5Returns the Footnote object associated with the chartW3Returns/sets the text to be used as the chart titleWWW;Determines whether all the series in the chart are stacked.WWWfReturns/sets how text is drawn to optimize the appearance either on the screen or on the printed page.6Determines whether the user can select chart elements.lDetermines whether clicking on an individual data point selects the entire series containing the data point.WWFDetermines whether or not the user can interactively rotate 3D charts.6Returns the number of series that appear on the chart.6Returns the Backdrop object associated with the chart.4Returns the Legend object associated with the chart.WW6Returns the DataGrid object associated with the chart.2Returns the Plot object associated with the chart.aReturns/sets whether to disable color dithering for charts in order to enhance the chart display.WJReturns/sets whether or not the mouse cursor type can be set by the chart./Returns whether the chart is three dimensional.WWW-Returns/sets the data to chart as a 2D array.W-Returns/sets the mouse pointer for the chart.W$Displays the About box of the chart.WWRepaints the chart.WWWPPastes a Windows Metafile graphic from the clipboard into the current selection.WWECopies the current chart to the clipboard in Windows Metafile format.W5Forces the chart to recalculate automatic attributes.W*Returns the chart to its initial settings.!Selects the specified chart part.W-Returns the currently selected chart element.W5Uses a set of coords on the chart to identify a part.WReturns/Sets whether this control can act as an OLE drag/drop source, and whether this process is started automatically or under programmatic control.@Returns/Sets whether this control can act as an OLE drop target.WWCStarts an OLE drag/drop event with the given control as the source.WWWReturns/sets data source.W%Returns/sets data source member name.W"Occurs when the chart is selected."Occurs when the title is selected.%Occurs when the footnote is selected.W#Occurs when the legend is selected.WWW!Occurs when the plot is selected.W Occurs when an axis is selected.WW&Occurs when an axis label is selected.&Occurs when an axis title is selected.$Occurs when a datapoint is selected.WW*Occurs when a datapoint label is selected.!Occurs when a series is selected.W4Occurs when the chart is activated (double-clicked).WW4Occurs when the title is activated (double-clicked).WW7Occurs when the footnote is activated (double-clicked).WWW5Occurs when the legend is activated (double-clicked).W3Occurs when the plot is activated (double-clicked).WWW2Occurs when an axis is activated (double-clicked).8Occurs when an axis label is activated (double-clicked).WW8Occurs when an axis title is activated (double-clicked).WW6Occurs when a datapoint is activated (double-clicked).<Occurs when a datapoint label is activated (double-clicked).WW3Occurs when a series is activated (double-clicked).WWWOccurs when an axis is updated.WWW%Occurs when an axis label is updated.W%Occurs when an axis title is updated.W!Occurs when the chart is updated.W$Occurs when the footnote is updated.WW"Occurs when the legend is updated. Occurs when the plot is updated.WW#Occurs when a datapoint is updated.WWW)Occurs when a datapoint label is updated.W Occurs when a series is updated.WW!Occurs when the title is updated.W$Occurs when the datagrid is updated.WW(Occurs after the chart finishespainting.WW+Occurs when the user clicks over the chart.WWW2Occurs when the user double clicks over the chart.AOccurs when the user presses a key while the chart has the focus.W0Occurs when the user presses and releases a key.WWBOccurs when the user releases a key while the chart has the focus.;Occurs when the user presses a mouse button over the chart.WWW4Occurs when the user moves the mouse over the chart.WW<Occurs when the user releases a mouse button over the chart.WW @  @ ,@@ @ @HP@@h4@x@T @@ @@,@ @@0@@l@P`h @x@l !4!L"(0 @PX%h1x=I@&t'@0@Ua(0|.@HdX`@p@my 00@$,,(0-@H1X` d2@p$@\@@45L6(07@H7X`8px3D/L@@h@ @))*(0\+@H,3X`<(pxl9@x@@#T$H @%% (4:8@8@PX@`@pWWWW(4` `(4H H(4I I(4J J(4K4 K(4LX L(4Lx (4M (4N ( 4O ( 4P ( 4Q ( 4R ( 4SL (4Tl (4U (4V (4W (4X (4Y$ (4ZP (4[h (4\ (4] (4^ (4_ (4`(4a8(4bd(4(4(4( 4(!4("4(#4<<($4=H=(%4>l>(&4??('4@@((400()411(*42 2(+43(3(,44<4(-45P5(.4||x|(/4(04(14(24(34(44(54x(64(74(84`@@@@@@@@@ @ @ @ @ @@@@@@@@@@@@@@@@@@@ @!@"@#@$@%@&@'@(@)@*@+@,@-@.@/@0@1@2@3@4@5@6@7@8@ 0Dl4PtHl @h(PxDp8Xt(Dd(Px@h0X Hp8`(Px@h0X HpD04 H \ D H$\ D< H(T |  4<,TD \  H0x\H\D( < LDp0 H$T  0(4 8<,D  $@0L D84 p  H8x(4(4((4d@@@Hd(PP(4(4@@((4L(4`(4t(4(4@@@@@,T|(Pxx(4(4(4  @@@(P(4""(4##(4$$(4%%@@@@<`|(Pxx(4''(4(0((4)H)@@@(Px(4+`+(4,t,(4--@@@8(Px(4//(400(411@@@X|(PP(433(444@@(x(4646(47<7(48D8@@@4T(PP(4:P:(4;`;@@t((4=l=(4>>(4??(4@@@@@@(Px(4BB(4CC(4DD(4E$E(4F@F(4G\G(4HtH(4II(4JJ( 4 KK( 4 LL( 4 MM( 4 NN( 4 OO(4PP(4Q$Q(4R4R(4SHS(@4TdT@@@@@@@@@ @ @ @ @ @@@@@@<`@lDh(Px@h0X(4VV(4WW(4XX(4YY(4ZZ(4[[(4\d\@@@@@@@ < ` (PxP(4^$^(4_0_@@ !((4a@a(4bLb(4cXc(4ddd(4epe(4ff(4gg(4hh(4ii( 4 jj@@@@@@@@@ @,!H!d!!!!!!"8"(Px@hx(4ll(4mm(4nn@@@T"p""(Px(4pp(4qq(4r$r@@@"""(P(4t4t(4u@u(4vhv(4ww(4xx@@@@@"#8#\##(Px(4zz(4{({(4|<|(4}(}(4~<~@@@@@###$ $(PxP(4\(4|@@<$d$((4(4(4(4h(4(4(4 @@@@@@@$$$$ %H%t%(Px(4, (4X (4 (4 @@@@%%% &(Pxx(4!(48!(@4\!@@@,&H&d&(P(4p!(4!(4!(4!(4!(4!(4!(4!(4!( 4 "( 4  "( 4 8"( 4 P"( 4 l"(4"(4"(4d@@@@@@@@@ @ @ @ @ @@@@&&&&' '@'`'''''$(P(|((((Px@h0X(4"(4"(4"(4#(4#@@@@@()()P)t)(Pxx(44#(4D#(4d#@@@)))(P(4#(4#(4#(4#@@@@ *$*@*\*(PxP(4#(4#@@x**(P(4#(4$@@**(`(4<$(4D$(4L$(4X$(4d$(4p$(4|$(4$(4$( 4 $( @4 $( @4 $( @4 $( @4 $(4$(@4%(4%(@4%(@4$%(@40%(@4<%(@4H%(@4T%(@4`%(@4l%(@4x%(@4%(@4d@@@@@@@@@ @ @ @ @ @@@@@@@@@@@@@@@+(+H+h+++++,0,X,,,,,-4-T-t-----.<.`...(Px@h0X Hp8(@4%(4%(4<$(4D$(@4$(@4$(@4$(4L$(4X$( 4d$( 4p$( 4 |$( 4 $( 4 %(@4 %(@4 %(@4%(@40%(@4<%(@4%(@4%(@4&(@4 &(@4H%(@4T%(@4$(4$(@4%(@4&(@4(&(@48&(@4H&( @4`&(!@4x&("@4 `%(#@4!l%($@4"%(%@4#d@@@@@@@@@ @ @ @ @ @@@@@@@@@@@@@@@@@@@ @!@"@#@$@%@../(/H/t////0(0H0h000001@1`11111 202P2p2222303`33333(Px@h0X Hp8`(PxX(4&(4&(4&(4&(4&(4&(4 '(4('(4<'( 4 X'( 4 l' ( 4 ' ( 4 ' ( 4 ' (4 d @@@@@@@@@ @ @ @ @ @@444T4t44444585T5x5555(Px@h0h(4'(4'(4'(4'(4'(4((4((4((4((@@@@@@@@@6(6H6l66666$7(Px@(40((4d((4((4)@@@@H7l777(Pxx(4<)(4X)(4 x) @@@7808(Ph(4")"(4#)#(4$)$(4%)%(4&*&(4' *'(4(L*((4)x*)(4***@@@@@@@@@T8|8888$9L9t99(Px@(4,*,(4-*-(4.*.(4/*/@@@@99 :P:(Pxx(41+1(42$+2(43@+3@@@:::(PP(45\+5(46x+6@@:;((48+8(49+9(4:+:(4;+;(4<+<@@@@@8;P;h;;;(Px(4>+>(4?+?(4@,@(4A ,A(4BD,B(4Cd,C@@@@@@;;<(<T<|<(Pxx(4E,E(4F,F(4G,G@@@<<<(P(4I,I(4J,J(4K-K(4L0-L(4MT-M(4Nt-N@@@@@@=0=X====(Px(4P-P(4Q-Q(4R-R(4S-S@@@@>$>H>l>(Px(4U.U(4V,.V(4WT.W(4X.X(4Y.Y@@@@@>>>>?(Px(4/(4(/(4@/(4X/(4p/(4/(4 /@@@@@@@ ?}J0\4 ~d>~``t >|I`IJK0d4 >HhT  ?IHlT l?hJxp ?KKKKKK`t ?hJI `L`xt @hJI LT|lD0@IJ($L Td!0@IJH\Dl@I(X^>Q $(D! <,LD?^?Q $0D!<4TDA^A L <8LDD<_D@Q $<D!< @LD Ex_ER $ DD! < HLD F_F@0R $ LD! < PLDG`G@DR $TD! <XLDHH`HTR $\D! <`LDI`I@lR $dD!<hLDJ`J@R $lD!<pTDK$aKR <tLDL|aLR $xD!<|LDMaM@R $D!<TDNbN <TDOlbO  <TDRbR8 <TDSbSP8 <TDU(cUh$ <LD VTD> m 0 <?TD? m H <@LDAn,U $A D!@ <B$LDCxnHU $C(D!B <D,LDDn`U <E0LDFanaU <F4D!Eana $G@8LDG0U <H<LDIb(obXU <I@D!Hb(obP0J@D4 JnXon0KH4 K`o`0LL4 Ldod0MP4 Meoe0NT4 Nf4pf0OX4 OglpglP\ PhphxVVVVVlQ` Qipi`xV`V`V`V`VRd RjpjW W`xV`V`V`V`V<ShLDT$qhHW <TlD!S$q`<UpLDVqx|W <VtD!Uqp0Wx4 Wr<X|TDYoHroW <YLAXoHro<ZLD[pdrpW <[D!Zpdrp  !!""#$&'(++--/HJJ124589;GGKK@S@S\S\S$P$PIIHIHI$L$L`I`ItStSSSSSSShJhJII|L|L|I|ISSSShOhOTTTT,T,TDTDTXTt hThTTTTTTTTTTT UL ,U,UHUHU`UtUtUUUUUUV V4VHV`VVV0W0WdWdWWWWWW<` \@|<` \@|<` \@|0 T  , h ( L < x  8 t LHx@|$` 0l S0(X0d 0dH`X0l S`X$ L 0dHl S0dH`X`X@F@F`Y` S0dH`X`X@F@FHd zrz`PY`hYHd {r{`PY`hYH d |r|`PY`hYH $d  }r}`PY`hYH (d  ~$s~`PY`hY` ,  Hs`O`Z`PY`hYx 0  ls`O`Z`8Z`J`PY`hY` 4  s`O`Z`PY`hY`8 s` ` `PY`hY`< s` ` `PY`hYT@| t` `PY`hYHDd 4t`PY`hYHHd lt`PY`hYHLd t`PY`hYHPd t`PY`hYHTd u`PY`hY`X Pu`O`Z`PY`hYx\ u`O`Z`8Z`J`PY`hY`` u`O`Z`PY`hY`d u` ` `PY`hY`h 4v` ` `PY`hYTl| tv` `PY`hYTp| v`O`Z`(\lt v`O`Z`8Z`J`(\Tx| v`O`Z`(\<|L  w`(\< L  Dw`(\<!L !lw`(\<"L "w`(\T#| #w` ` `(\T$| $w` ` `(\H%d %x` `(\<&L &,x`(\x' 'Px`hJ`I`d]`x]`8Z`(\0(4 (xx0)4 )x0*4 *xH+\ +y`]X<,L ,Ly` ^H-\ -y`]X`.t .yXXFF`/t /zXXFF`0t 0E$PVE$P>Y$PVY$P718OrientationP?*(PM )PM 5PM *D@nMS Sans SerifP A&xis:!P"F7PbPLineP 2&Width:!P*18v^$P L&Color:P*K8 _$VCIColorComboPpgAxis ScaleP} Q Show sca&leP}Q #A&utomatic scalingP'9Mi&nimum:P$ #P85&Maximum:P5 #PI<:$Major &divisions:PI<8$&Divisions per label:PF #P[99$Divisi&ons per tick:P[9;$Min&or divisions:PW $D@nMS Sans SerifP5Property &Name:!P=F3#PtHInteriorP $&Color:P8!8 .VCIColorComboP 7)&Pattern:P858 /VCIPatternComboP J+ Pa&ttern Color:P8I8 0VCIColorComboPtHBorderP$Styl&e:!P!8F1P7&Width:P58 2PJ C&olor:PI8 3VCIColorComboPb4 4&ShadowD@nMS Sans SerifP A&xis:!P"F7PsJMajor GridlinesP-&Style:!P1+:v#PA&Width:!P1?:v#PV&Color:P1S: VCIColorComboPrJMinor GridlinesP.S&tyle:!P+:v=PBW&idth:!P?:vU$PVC&olor:PS: VCIColorComboColorD@nMS Sans SerifP &Series:!P"Wv&P (Series &type:!PF;yPtPInteriorP + &Color:P;)8 VCIColorComboP A%&Pattern:P;?8 yVCIPatternComboP W.Pattern c&olor:P;T8 VCIColorComboPsPEdge/LineP+Styl&e:!P)8vyPA"&Width:!P?8v#PW!Colo&r:PT8 VCIColorComboD@nMS Sans SerifP &Series:!P Uv&P &Series &type:!PB3yP lPStatisticsP"U $Mi&nimumP/U Ma&ximumP<U !&MeanPIU "Stan&dard deviationPVU #&RegressionPlPOptionsP$I #H&ide seriesP4M y&Exclude seriesPDI y&Plot on 2nd Y axisPTI $Sh&ow markersȀ7About Microsoft Chart ControlMS Sans SerifP2OKP ABOUT_BITMAPP" Microsoft Chart Control, Version 6.00.00P"Copyright 1993-97, Visual Components, Inc.(0R A^8  Nb()H()H(0*(06I*(0(0(0((()Pqeeel ()H(Z08ۀ~VݾVV8ћoݞ8ۀnVnVnVn8ћoƶvvqƌƶvvƌƶvvvƌƶvƌƶvvqƌqƶqƌƶƌblZkbhmUUUUUUzkoThe list of error codesHorizontal Alignment ConstantsHorizontal leftHorizontal rightHorizontal centerFillFlush Vertical topVertical bottomProperty is write-onlyInvalid procedure callInvalid object use-Specified format doesn't match format of dataXDataObject formats list may not be cleared or expanded outside of the OLEStartDrag eventExpected at least one argument.1Illegal recursive invocation of OLE drag and dropNon-intrinsic OLE drag and drop formats used with SetData require Byte array data. GetData may return more bytes than were given to SetData.NRequested data was not supplied to the DataObject during the OLESetData event.No errorGeneral failure'Attempted to delete object still in use*Attempted to delete object already deleted Corrupt data; unable to continueFunction not yet implementedNot enough memoryBad function argumentCannot find item!Result too long for return buffer Inappropriate or invalid requestFailed to read or write a file(Failed to write to user-created functionPersistent storage corrupted&Attempted to load incompatible versionUnexpected class type(Attempted to load pointer into referenceUnable to open requested file(Failed to load string; possibly too long)String buffer too small; string truncatedFailed to copy objectEncountered duplicate objectUser canceled operationIndex given is out of bounds+Requested type conversion is not supported.#Object is uninitialized or invalid.Could not create window.)This version of Windows is not supported.!Could not load requested picture.Invalid Syntax.Identifier too big.Unrecongized function name.Unrecongized symbol.Unexpected end of string.Duplicate Symbol.(Error communicating with display drivers!Requested font name not available"Requested font description invalidNot enough display resources&Default substituted for requested fontNon-specific chart errorInvalid chart handleNecessary data unavailableNonexistent seriesNonexistent axis%Operation not allowed in this versionSurface Display Type ConstantsSurface Display - NoneSurface Display - CBandsSurface Display - CLinesSurface Display - Solid!Surface Display - SolidWithCLines!Surface Projection Type ConstantsSurface Projection - NoneSurface Projection - CBandsSurface Projection - CLines Surface Wireframe Type ConstantsSurface Wireframe - NoneSurface Wireframe - Major!Surface Wireframe - MajorAndMinorVertical Alignment ConstantsBorder Style ConstantsVertical centerOrientation ConstantsHorizontal text Vertical textUp oriented textDown oriented textSort Type ConstantsSort Type - NoneSort Type - AscendingSort Type - DescendingAngle Units ConstantsDegree Angle UnitsRadian Angle UnitsGrad Angle UnitsPrint Scale Type ConstantsPrint Scale Type - ActualPrint Scale Type - FittedPrint Scale Type - Stretched Print Orientation Type ConstantsPrint Orientation - PortraitPrint Orientation - LandscapeThe list of VtFont stylesBoldItalicOutlineThe list of VtFont effectsStrike Through Underline Brush Styles"No brush(background shows through)Solid VtColor brushBitmap patterned brush Hatched brushBrush Patterns94 percent pattern color88 percent pattern color75 percent pattern color50 percent pattern color25 percent pattern colorBold Horizontal LinesBold Vertical LinesBold Down Diagonal LinesBold Up Diagonal LinesChecks pattern Weave patternHorizontal LinesVertical Lines Down Diagonal Up Diagonal Grid PatternTrellis PatternInverted Trellis Pattern&Number of elements in this enumeration Brush HatchesHorizontal Hatch LinesVertical Hatch LinesDown Diagonal Hatch LinesUp Diagonal Hatch LinesCross Hatch LinesDiagonal Cross Hatch Lines&Number of elements in this enumeration Shadow Styles No shadow Drop shadow Pen StylesNull pen Solid pen Dashed pen Dotted pen Dash-dot penDash-dot-dot penDitted line penDitted line pen Dash-dit penDash-dit-dit penPen Join typesMitered pen joinRound pen joinBeveled pen join Pen Cap types Butt pen cap Round pen capSquare pen cap Frame StylesNo frame$A Single line encloses the backdrop.+Two equal width lines enclose the backdrop.>A thick inner line and a thin outer line enclose the backdrop.>A thin inner line and a thick outer line enclose the backdrop. Picture Types No graphic.Windows bitmap.Microsoft Windows Metafile.Windows bitmap.Microsoft Windows Metafile.Picture Options (WMF only)Omit Adobe placeable header.Replace text with polygons.Picture Map Types9Displays the graphic at the original size it was created.;Scales the graphic proportionally to fit within the object.MScales the graphic to fill the object regardless of its original proportions.5Duplicates the graphic repeatedly to fill the object.DCenters the graphic and scales it proportionally to fill the object.Tiles the graphic horizontally.Tiles the graphic vertically.Gradient Styles'The VtColor changes from top to bottom.'The VtColor changes from left to right.FThe VtColor changes in concentric rectangles from the center outwards.AThe VtColor changes in concentric ovals from the center outwards.Fill Style Constants#No fill. (background shows through) A solid VtColor or pattern fill.A gradient fill.Marker Style Constants Dash marker Plus markerX marker Star marker Circle marker Square markerDiamond markerTriangle markerDown triangle markerFilled circle markerFilled square markerFilled diamond markerFilled up triangle markerFilled down triangle marker3D Ball No Marker&Number of elements in this enumerationProjection Type ConstantsPerspective projection"2.5 dimensional oblique projection%Orthogonal projection(no perspective)Frontal projectionOverhead projectionSmoothing Type Constants No smoothingQuadratic BSpline smoothingCubic BSpline smoothingDevice Context Type ConstantsDevice context type NullDevice context type DisplayDevice context type PrinterDevice context type Metafile2D Text output Type ConstantsDevice context type NullDevice context type MetafileText Length Type ConstantsTT virtual text length#Actual length used by output deviceThe list of Chart types3d Bar2d Bar3d Line2d Line3d Area2d Area3d Step2d Step3d Combination2d Combination3d Horizontal Bar2d Horizontal Bar3d Clustered Bar3d Pie2d Pie 3d Doughnut2d XY2d Polar2d Radar 2d Bubble2d HiLo2d Gantt3d Gantt 3d Surface 2d Contour 3d Scatter3d XYZ&Number of elements in this enumerationThe list of Series types$Used by UI to describe combo charts.Default3d Bar2d Bar3d Horizontal Bar2d Horizontal Bar3d Clustered Bar3d Line2d Line3d Area2d Area3d Step2d Step2d XY2d Polar 2d Radar Line 2d Radar Area 2d Bubble2d HiLo 2d HiLoClose 2d HLC Right2d OHLC 2d OHLC Bar2d Gantt3d Gantt3d Pie2d Pie 3d Doughnut2d Dates 3d Bar HiLo 2d Bar HiLo3d Horizontal Bar HiLo2d Horizontal Bar HiLo3d Clustered Bar HiLo 3d Surface 2d Contour3d XYZ&Number of elements in this enumerationChart Part Type ConstantsPart type - chartPart type - titlePart type - footnotePart type - legendPart type - plotPart type - seriesPart type - series labelPart type - pointPart type - point labelPart type - axisPart type - axislabelPart type - axistitlePart type - series namePart type - point name&Number of elements in this enumeration%Chart Element Location Type ConstantsTop leftTop Top rightLeftRight Bottom leftBottom Bottom rightCustom+The list of datapoint label component types1The value of the data point appears in the label.gThe value of the data point is displayed in the label as a percentage of the total value of the series.0The series name is used to label the data point.4The data point name is used to label the data point..The list of series/datapoint label line stylesLabel Line Style - NoneLabel Line Style - StraightLabel Line Style - Bent,The list of series/datapoint label locationsLabel Location - NoneLabel Location - AbovePointLabel Location - BelowPointLabel Location - CenterLabel Location - Base'Label Location - Inside pie or doughnut(Label Location - Outside pie or doughnutLabel Location - LeftLabel Location - Right&Sub Plot Label Location Type ConstantsLocation Type - NoneLocation Type - AboveLocation Type - BelowLocation Type - CenterPie Weight Basis ConstantsPie Weight Basis - NonePie Weight Basis - TotalPie Weight Basis - SeriesPie Weight Style ConstantsPie Weight Style - AreaPie Weight Style - DiameterAxis Id ConstantsX AxisY AxisY2 AxisZ AxisNo AxisDate Interval ConstantsDate Interval Type - NoneDate Interval Type - DailyDate Interval Type - Weekly Date Interval Type - SemimonthlyDate Interval Type - MonthlyDate Interval Type - YearlyScale Type ConstantsScale Type - LinearScale Type - LogarithmicScale Type - PercentPercent Axis Basis ConstantsPercent Axis Basis - MaxChartPercent Axis Basis - MaxRowPercent Axis Basis - MaxColumn Percent Axis Basis - MaxSumChartPercent Axis Basis - MaxSumRow!Percent Axis Basis - MaxSumColumnAxis Tick Style ConstantsAxis Tick Style - NoneAxis Tick Style - CenterAxis Tick Style - InsideAxis Tick Style - OutsideStat Type Constants&Shows the minimum value in the series.&Shows the maximum value in the series.8Shows the mathematical mean of the values in the series.9Shows the standard deviation of the values in the series.7Shows a trend line indicated by the values in a series.Mouse Flag ConstantsShift key downControl key down.The list of Formula One spreadsheet link modesOffOnUpdate Flag ConstantsNo effect on chart appearance.Update plot display.Update plot layout.Update legend display.Update legend layout.Update series layout.Update section position. Auto ParseThe list of Draw modes$Draws directly to the display device0Blits an offscreen drawing to the display deviceContour VtColor Type ConstantsContour VtColor - AutomaticContour VtColor - GradientContour VtColor - ManualContour Display Type ConstantsContour Display - CBandsContour Display - CLinesSurface Base Type ConstantsSurface Base - PedestalSurface Base - Standard!Surface Base - StandardWithCBands!Surface Base - StandardWithCLines No border.Fixed single line border.Mouse Pointer ConstantsDefault chart pointer.Arrow pointer.Crosshair pointer.I beam pointer. Icon pointer. Size pointer.Size NE SW pointer.Size N S pointer.Size NW SE pointer.Size WE pointer.Up arrow pointer.Hourglass (wait) pointer.No drop pointer.Arrow and hourglass pointer. Arrow and question mark pointer.Size all pointer.Determines whether the current data point row and column is automatically incremented after the Data property is used to enter or update data in the data grid.=Determines whether random data is used to generate the chart.FReturns/sets the type of chart used to plot the data in the data grid.0Returns/sets the active column in the data grid.4Returns/sets the number of columns in the data grid.TReturns/sets the label associated with the column identified by the Column property.TReturns/sets the number of levels of labels above the data columns in the data grid./Identifies a particular level of column labels.^Returns/sets the value of a specific data point in the data grid identified by Column and Row./Returns/sets the text used as a chart footnote.JDetermines whether the chart repaints after a change is made to the chart.-Returns/sets the active row of the data grid.1Returns/sets the number of rows in the data grid.NReturns/sets the label associated with the row identified by the Row property.YReturns/sets the number of levels of labels to the left of the data rows in the data grid,Identifies a particular level of row labels.NReturns/sets the column of the chart in which the current series is displayed.YReturns/sets the chart type used to display the series identified in the Column property.8Determines whether the legend is displayed on the chart./Determines when and how the chart is repainted.3Returns the Title object associated with the chart.Repaints the chart.-Returns/sets the data to chart as a 2D array.-Returns/sets the mouse pointer for the chart.StdFont Object (write-only)PPastes a Windows Metafile graphic from the clipboard into the current selection.ECopies the current chart to the clipboard in Windows Metafile format.5Forces the chart to recalculate automatic attributes.*Returns the chart to its initial settings.!Selects the specified chart part.-Returns the currently selected chart element.5Uses a set of coords on the chart to identify a part.9Converts a data point value to its window pixel location./Returns or sets the border style for the chart.'Returns the window handle of the chart.$Displays the About box of the chart.Returns/sets data source.5Returns the Footnote object associated with the chart3Returns/sets the text to be used as the chart title;Determines whether all the series in the chart are stacked.fReturns/sets how text is drawn to optimize the appearance either on the screen or on the printed page.YDetermines whether the end user can use built-in dialog boxes to change chart properties.6Determines whether the user can select chart elements.lDetermines whether clicking on an individual data point selects the entire series containing the data point.FDetermines whether or not the user can interactively rotate 3D charts.6Returns the number of series that appear on the chart.6Returns the Backdrop object associated with the chart.4Returns the Legend object associated with the chart.6Returns the DataGrid object associated with the chart.2Returns the Plot object associated with the chart.aReturns/sets whether to disable color dithering for charts in order to enhance the chart display.JReturns/sets whether or not the mouse cursor type can be set by the chart./Returns whether the chart is three dimensional. Coor object X coordinate Y coordinate"Sets the x and y coordinate values LCoor object X coordinate Y coordinate"Sets the x and y coordinate values Rect objectMinimum Coor object%Returns/sets data source member name."Occurs when the chart is selected."Occurs when the title is selected.%Occurs when the footnote is selected.#Occurs when the legend is selected.!Occurs when the plot is selected. Occurs when an axis is selected.&Occurs when an axis label is selected.&Occurs when an axis title is selected.$Occurs when a datapoint is selected.*Occurs when a datapoint label is selected.!Occurs when a series is selected.4Occurs when the chart is activated (double-clicked).4Occurs when the title is activated (double-clicked).7Occurs when the footnote is activated (double-clicked).5Occurs when the legend is activated (double-clicked).3Occurs when the plot is activated (double-clicked).2Occurs when an axis is activated (double-clicked).8Occurs when an axis label is activated (double-clicked).8Occurs when an axis title is activated (double-clicked).6Occurs when a datapoint is activated (double-clicked).<Occurs when a datapoint label is activated (double-clicked).3Occurs when a series is activated (double-clicked).Occurs when an axis is updated.%Occurs when an axis label is updated.%Occurs when an axis title is updated.!Occurs when the chart is updated.$Occurs when the footnote is updated."Occurs when the legend is updated. Occurs when the plot is updated.#Occurs when a datapoint is updated.)Occurs when a datapoint label is updated. Occurs when a series is updated.!Occurs when the title is updated.$Occurs when the datagrid is updated.(Occurs after the chart finishespainting.+Occurs when the user clicks over the chart.2Occurs when the user double clicks over the chart.AOccurs when the user presses a key while the chart has the focus.0Occurs when the user presses and releases a key.BOccurs when the user releases a key while the chart has the focus.;Occurs when the user presses a mouse button over the chart.4Occurs when the user moves the mouse over the chart.<Occurs when the user releases a mouse button over the chart.Maximum Coor objectVtColor object Red value Green value Blue valueAutomatic VtColor selectionSet red, green, and blue values Pen objectThe type of line$Defines how line segments are joined Defines how line ends are capped!The VtColor used to draw the line)Defines the width, in points, of the line7Defines the joint limit as a multiple of the line width Marker objectDetermines if marker is visibleThe type of marker#The pen used to draw marker outlineSize of the marker in pointsVtColor used to fill the markerVtPicture used for markerTextLayout object$Defines horizontal alignment of text"Defines vertical alignment of textDefines orientation of textText Word WrapLocation object Rect objectDetermines if text is visible#Determines the position of the text VtFont objectThe name of the VtFontSize of the VtFont in pointsDefines styles of the VtFontDefines effects of the VtFontVtFont VtColor object Brush objectDefines the style of the brushFill VtColor objectPattern VtColor object!Defines the pattern for the brush Shadow object=Determines whether this shadow object\'s parent has a shadow.5Returns the Brush object associated with this shadow.`Returns the Coor object that describes the distance the shadow is offset from its parent object. Fill objectThe type of fill.ABrush object that describes the brush used in a brush style fill. Frame objectThe type of frameThe VtColor of the frame'The VtColor of the space between frames"The width, in points, of the frameBackdrop object Shadow object Frame object Fill object Title objectText Layout objectReturns/sets the title textLocation objectBackdrop object VtFont object%Returns the length of the title text.Selects the chart title.Footnote objectText Layout objectLocation objectBackdrop object VtFont objectReturns/sets the footnote text(Returns the length of the footnote text.Selects the chart footnote. Legend objectLocation objectBackdrop object VtFont objectText Layout objectSelects the chart legend.DataGrid object9Returns/sets the number of data columns in the data grid.MReturns/sets the number of levels of labels on data columns in the data grid.JReturns/sets the number of levels of labels on data rows in the data grid.6Returns/sets the number of data rows in the data grid.GDeletes columns of data and their associated labels from the data grid./Adds one or more data columns to the data grid.>Deletes levels of labels from the data columns in a data grid.GAdds one or more levels of labels to the data columns in the data grid.DDeletes rows of data and their associated labels from the data grid.,Adds one or more data rows to the data grid.;Deletes levels of labels from the data rows in a data grid.DAdds one or more levels of labels to the data rows in the data grid.1Fills the data grid with randomly generated data.4Sets the number and levels of data columns and rows.NAssigns each label in the first level of data grid labels a unique identifier.HFills one or more columns of the data grid with randomly generated data.EFills one or more rows of the data grid with randomly generated data.(Moves a block of cells on the data grid.#Gets the value of a data grid cell.#Sets the value of a data grid cell.9Returns/sets the label on a data column in the data grid.HReturns the multi-level label that identifies a column in the data grid.EReturns the multi-level label that identifies a row in the data grid.6Returns/sets the label on a data row in the data grid.LightSource objectEReturns/sets the strength of the light coming from the light source.CReturns/sets the X coordinate for the location of the LightSource.CReturns/sets the Y coordinate for the location of the LightSource.CReturns/sets the Z coordinate for the location of the LightSource.]Sets the X,Y,Z coordinates for the LightSource location and the intensity of the LightSource.LightSources Collection(Add a new LightSource to the collection.)Remove a LightSource from the collection.9Returns a specific item from the LightSources collection. Light objectEReturns/sets the percentage of ambient light illuminating a 3D chart.CReturns/sets the intensity used to display the edges on a 3D chart.EDetermines whether edges are displayed on the elements in a 3D chart.A collection of light sources. View3d objectCReturns/sets the degree of rotation from which the chart is viewed.DReturns/sets the degree of elevation from which the chart is viewed.:Sets the rotation and elevation used to display the chart.PlotBase object4Returns/sets the height of the chart base in points.8Returns the brush object associated with the chart base.4Returns the pen object associated with the pen base.Doughnut object;Returns/sets the number of sides used to draw the doughnut.oReturns/sets the ratio of the radius of the doughnut that is used to display the interior hole in the doughnut.5Sets the attributes used to display a doughnut chart. Pie object]Returns/sets the percentage of a pie radius that is used to determine the height of a 3D pie.hReturns/sets the percentage of a pie radius that is used to determine the size of the top of the 3D pie./Sets the attributes used to display pie charts.Weighting objectJReturns/sets the type of weighting used to determine pie or doughnut size./Determines how the weighting factor is applied.hSets the size of each 2D or 3D pie or doughnut in relation to other pies or doughnuts in the same chart. Wall objectAReturns/sets the thickness of the walls of a 3D chart, in points.8Returns the Brush object associated with the chart wall.6Returns the Pen object associated with the chart wall. Bar object6Returns/sets the number of sides displayed on the bar.UReturns/sets the percentage of the base size that is used to draw the top of the bar. HiLo objectHReturns the VtColor object used to show elements that have gained value.FReturns the VtColor object used to show elements that have lost value.SeriesPosition object7Determines whether a series is excluded from the chart.CDetermines whether a series is hidden (not displayed) on the chart.5Returns/sets the position of the series in the chart.^Returns/sets position in which the current series is drawn if it is stacked with other series.SeriesMarker objectkDetermines whether to automatically assign the next available marker type to all data points in the series.7Determines whether markers are displayed for the seriesStatLine objectBDetermines which statistic lines are being displayed for a series.3Returns the VtColor object for this statistic line.=Returns/sets the thickness of the statistics line, in points.>Returns/sets the line type used to display the statistic line. Label object7Returns the Backdrop object associated with this label.2Returns/sets the format used to display the label.:Returns/sets the VtFont object associated with this label.ZDetermines whether to automatically rotate the label if it would improve the chart layout.Determines whether axis labels are displayed laying down in the X or Z plane or rotated up on the text baseline to stand in the Y plane.9Returns the TextLayout object associated with this label.(Returns the length of the format string.Labels CollectionDataPointLabel object"Returns/sets the point label text.BReturns the Backdrop object associated with this data point label.@Returns the VtFont object associated with this data point label.wReturns the LCoor object which describes the offset of the data point label from one of the predefined label positions.DReturns the TextLayout object associated with this data point label.=Returns/sets the standard position used to display the label.?Determines whether custom text is used to label the data point.@Returns/sets the type of label to be used to identify the point.aReturns/sets the type of line used to connect a pie slice to a label displayed outside the slice.=Returns/sets the format used to display the label as a value.?Returns/sets the format used to display the label as a percent.0Returns the length of the data point label text.PResets any custom attributes placed on a data point label to the series default.Selects a data point label.DataPoint objectBReturns the DataPointLabel object associated with this data point.9Returns the Brush object associated with this data point.?Returns the Pen object used to draw the edge of the data point.:Returns the Marker object associated with this data point.fReturns/sets how far the pie slice representing this data point is offset or pulled away from the pie.JResets any custom attributes placed on a data point to the series default.!Selects an individual data point.DataPoints Collection Series object?Determines whether a series is charted on the secondary Y axis.IReturns/sets the type of mathematical function used to smooth the series.zReturns/sets the number of facets or points that are sampled between the chart data points to create the smoothing effect.LReturns/sets the series type being used to display this series in the chart.>Returns the Pen object associated with this series guidelines.4Determines whether a line is displayed for a series.3Returns the Pen object associated with this series.3Returns the Bar object associated with this series.4Returns the HiLo object associated with this series.8Returns the Position object associated with this series.<Returns the SeriesMarker object associated with this series.;Returns the SeriesLabel object associated with this series.8Returns the StatLine object associated with this series.4Retruns the collection of datapoints in this series.CSets or returns the text that identifies this series in the legend.Selects a chart series.=Determines whether the guidelines are displayed for a series.RReturns the series type used to draw the series if chart type is set to ChartType.SeriesCollection CollectionAxisTitle object,Returns/sets the text used as an axis title.<Returns the Backdrop object associated with this axis title.:Returns the VtFont object associated with this axis title.-Determines whether the axis title is visible.>Returns the TextLayout object associated with this axis title.%Returns the length of the axis title.CategoryScale object4Determines whether the axis is automatically scaled.;Returns/sets how many divisions are skipped between labels.?Returns/sets how many divisions are skipped between tick marks.ODetermines where category axis labels are positioned relative to the axis tick.DateScale object4Determines whether the axis is automatically scaled.1Returns/sets the beginning date on the date axis..Returns/sets the ending date on the date axis.IReturns/sets the type of major interval used to display dates on an axis.PReturns/sets how many major intervals pass before a label is placed on the axis.IReturns/sets the type of minor interval used to display dates on an axis.PReturns/sets how many minor intervals pass before a label is placed on the axis.MDetermines whether dates that fall on the weekend are displayed on the chart.AxisGrid object>Returns the Pen object used to draw the minor axis grid lines.>Returns the Pen object used to draw the major axis grid lines.Intersection objectJDetermines whether the chart uses the value of Point to position the axis.LReturns/sets where the current axis intersects the axis perpendicular to it.Identifies a specific axis.Reserved for future use.%Axis labels are adjacent to the axis. Tick object?Returns/sets the length of axis tick marks, measured in points.+Returns/sets the position of the axis tick.AxisScale object&Determines whether the axis is hidden.$Returns/sets the type of axis scale.PReturns/sets the logarithm base used to plot chart values on a logarithmic axis.PReturns/sets the type of percentage used to plot chart values on a percent axis.ValueScale object>Determines whether automatic scaling is used to draw the axis.BReturns/sets the lowest or beginning value used to scale the axis.@Returns/sets the highest or ending value used to scale the axis.AReturns/sets the number of major divisions displayed on the axis.\Returns/sets the number of minor divisions displayed within each major division of the axis.Axis(axisId, 1) objectBReturns the Pen object used to draw the axis lines and tick marks.8Returns the number of levels of labels for a given axis.;Returns the CategoryScale object associated with this axis.7Returns the DateScale object associated with this axis.6Returns the AxisGrid object associated with this axis.:Returns the Intersection object associated with this axis.2Returns the Tick object associated with this axis.3Returns the Scale object associated with this axis.8Returns the ValueScale object associated with this axis.7Returns the AxisTitle object associated with this axis.A group of chart axis labels. Plot object;Returns/sets the unit of measure used for all chart angles.UDetermines whether pie charts are drawn in a clockwise or counterclockwise direction.JReturns/sets the order in which the slices of a pie or doughnut are drawn.jReturns/sets the percentage of the shortest chart axis that is used as the diameter of the largest bubble.;Returns the Backdrop object associated with the chart plot.cReturns the Coor3 object which indicates the distance and position from which a 3D chart is viewed.LReturns/sets the angle at which the scale appears on a polar or radar chart.8Returns/sets the starting angle used to draw pie charts.WReturns/sets the position used to display a label on each pie or doughnut in the chart.8Returns/sets the spacing of 2D and 3D bars in the chart.3Returns/sets the x spacing of 3D bars in the chart.8Determines whether the plot is in automatic layout mode.NReturns/sets the percentage of the chart height to be used as the chart width.NReturns/sets the percentage of the chart height to be used as the chart depth.SReturns the Rect object which indicates the position of the plot area of the chart.RReturns/sets the projection type used to display a 3D chart on a 2D output device.3Returns/sets the z spacing of 3D bars in the chart.`Returns the View3d object which indicates the rotation and elevation used to display a 3D chart.<Returns the PlotBase object associated with this chart plot.<Returns the Doughnut object associated with this chart plot.7Returns the Pie object associated with this chart plot.=Returns the Weighting object associated with this chart plot.8Returns the Wall object associated with this chart plot.=Returns the Elevation object associated with this chart plot.Series Collection\Indicates whether series data is being read from a row rather than a column in a data grid.&The light source illuminating a chart.8The point at which the axes of a 3D XYZ chart intersect.PReturns/sets the type of percentage used to plot chart values in a percent axis.QSpecifies whether or not the unit scale for all value axes in a chart is uniform.8Returns the Axis object associated with this chart plot. Chart objectNumber of items in a collection"Returns one item from a collectionEnumerates over a collectionMicrosoft Chart Control 6.0'Event interface for MSChart Control 6.0Chart Property PageXConstants for the OLEDragMode property (but not the DragMode or OLEDropMode properties).BOLE drag/drop will be initialized only under programmatic control.jOLE drag/drop will be initialized when the user drags 'out' of the control, or under programmatic control.XConstants for the OLEDropMode property (but not the DragMode or OLEDragMode properties).$Accepts no OLE drag/drop operations.9Accepts an OLE drag/drop under programmatic control only.6Accepts an OLE drag/drop without programmatic control.CState transition constants for the DragOver and OLEDragOver events.#Source control dragged into target.%Source control dragged out of target.>Source control dragged from one position in target to another.Clipboard format constants.Text (.TXT file).Bitmap (.BMP file).Metafile (.WMF file).Device-independent bitmap.Color palette.Enhanced metafile (.EMF file).*Filename list (Microsoft Windows Explorer)Rich Text Format (.RTF file).3Drop effect constants for OLE drag and drop events.<No OLE drag/drop operation has taken place/would take place.@A mask to indicate that a copy has taken place/would take place.?A mask to indicate that a move has take place/would take place.IA mask to indicate that the drop target window has scrolled/would scroll.CStarts an OLE drag/drop event with the given control as the source.Returns/Sets whether this control can act as an OLE drag/drop source, and whether this process is started automatically or under programmatic control.@Returns/Sets whether this control can act as an OLE drop target.3Clears all data and formats in a DataObject object.QDetermines if a specified clipboard format is supported by the DataObject object.>Retrieves data of a specified format from a DataObject object.EAdds a supported format and possibly its data to a DataObject object.7A collection of filenames used by the vbCFFiles format.nReturns a specific filename by index from the Files collection of a DataObject object (vbCFFiles format only).gReturns the number of filenames in the Files collection of a DataObject object (vbCFFiles format only).WAdds a filename to the Files collection of a DataObject object (vbCFFiles format only).cClears all filenames stored in the Files collection of a DataObject object (vbCFFiles format only).\Removes a filename from the Files collection of a DataObject object (vbCFFiles format only).Valid range is from %s to %s Invalid ValueInvalid format code '%s' (%d).%Maximum must be greater than minimum.Value must not be less than %s 3D Shadow Gray Text Button TextInactive Title Bar Text 3D Highlight3D Dark Shadow3D Light Shadow Info TextInfo BackgroundStartShortLongFloatDoubleBooleanCurrencyDateStringLeftRightCenterArial10 mmmm yyyymmmmyyyy Automatic Custom...NoneSolid1Arial12 MS Sans Serif8 Scroll BarsDesktopActive Title BarInactive Title BarMenu BarWindow Background Window Frame Menu Bar Text Window TextActive Title Bar Text Active BorderInactive BorderApplication Workspace HighlightHighlighted Text3D FaceColorsColor Property PageFontsFont Property PagePicturesPicture Property PageDesktopApplication WorkspaceWindow Background Window TextMenu Bar Menu TextActive Title BarInactive Title BarActive Title Bar TextInactive Title Bar Text Active BorderInactive Border Window Frame Scroll Bars Button Face Button Shadow Button TextButton Highlight Disabled Text HighlightHighlighted TextRegularBoldItalic Bold ItalicAll Picture Types|*.bmp;*.cur;*.dib;*.emf;*.ico;*.wmf|Bitmaps (*.bmp;*.dib)|*.bmp;*.dib|Icons/Cursors (*.ico;*.cur)|*.ico|Metafiles (*.wmf;*.emf)|*.emf;*.wmf|All files (*.*)|*.*||Browse PicturesSUnable to open the picture file %1. The file may not exist, or may not be readable.HUnable to load the picture file %1. The file may have an invalid format.KUnable to load the picture file %1. The file is too large to fit in memory.=Unable to load the picture file %1. Unexplained read failure.7Created by Visual Components, Inc. First Impression v%sChart(Chart properties for the MSChart control All SeriesAxis Axis GridSeries Series ColorBackdropText#Axis properties for MSChart Control(Axis Grid properties for MSChart control%Series properties for MSChart control/Series Color properties for the MSChart controlChartTitleFootnoteBackdropOptionsFont Backdrop2Picture 3D Lighting3D View GuidelinesMarkersAxis Scale and TicksAxis Line and Grids ElevationLinesLocationCustom LocationLayoutTextOrder Chart Type Plot Walls X Axis Title Y Axis Title Z Axis TitleSecond Y Axis TitlePlotLegendX AxisY Axis Second Y AxisZ Axis Axis Title Axis Labels - LevelSeries Series Labels DatapointDatapoint LabelsOblique Orthogonal Perspective Axis LineMajor GridlineMinor GridlineDegreesRadiansGradNone Ascending DescendingNoneTotalSeriesLines and ColorsFormat Value FormatPercent Format Bar (Column)Bar/Pictograph Line (Tape)LineAreaAreaStepStep Combination CombinationHorizontal BarHorizontal BarPiePieDoughnut X Y (Scatter)PolarRadarBubble Clustered BarHi LoGanttGanttContourSurfaceScatterXYZ+Backdrop properties for the MSChart control'Text properties for the MSChart controlMicrosoft ChartBarNone Single Line Double Line Thick Inner Thick Outer0 00)00112 22%2 333$3*363333334)4B4c4q4~444>5G55556'6O6l6u6666668#838R8b8{8888888999:9:::;6<<<]>>>>>>Y?}??? 0J1223(3K3y33333P4h4q44444445596w666+777y889"989u999999:-:X::;;;;.<;>??0@u001#1112_2i223q4z444 5F55555883:T;Z;;<=@pB1112 363344+55566666G7j7r77777778*8M8X8{8888%9\9;;Yt>>>?U?????P030V0|00001I1g11!20222T3333;4R4g4444B5J5\5h5555556#6;6A6Y6d6668=8w88e99 ;3;b;h;;;<[>>>>>>>??2?7?D?P?b??????`H0+00011:2D233i5888j99%:/:L:Y:::u<>>!?.?X??????p0$0?00000000000000000000000011 11S1w1`3v3334444444445J5Z5f5r5~5556N6U6[6k66666&7:777d8s889A9O9^9e9 :::%:,:?:M:T:Y; <<$(~01114D44g667d;^>?$1.2=2S2E34447{;;A,0i0022+3z334/4V4888O9d9<=$w123687P77U:::;Y<)>,?O?$k23o5B6678899;;r<<L1r2j3{350676o7j:{:::;;;<<$<><`<<<<<-=E=W==>>???T0x1E2S2k222<3_34444444G5[5`5i5m5t5{555'959@9Q9m99,:I:::; <@22245B5X5r555[6a6 8Q89,:a;s;;'<6<===>>?HC000.1U1111K2c2n22223444P45568;)<<<$==!>>?? <Z00002P3]33344456789T;b;q<>>>>>j?0<00x11112333345667788?9992:,<<<@801\11@2[22333f4559Q:\:b:}::<< ====>P=11222M222222223*3n333333"4*42474;4?4C4G4K4O4S4`4d4h4l4p4t4x4|444444444444444444555 555555k7889t;;;;'9?@???`X0/00061|112@2F2g2244%5|8889:::i;;;<1<<<]==V>>? ?E????pD0c0j00000A123334-464G4j44444B5S55556;6h66667I7v7777I8888:9Y9`99999:8:B:l:::::P;\;;;6<<<@>J>>>H<0o000111B2223F3w3355N67 9::::e;<=q>>>??X030W0i000011*11o222222222222.3R344n55X79t::.;==>=???8000 12 5%6666!7(7T77G9_9::;;]>>???00012%2K2303S3_647>729N9_99999!:?:R:::::!;.;G;\;m;;;;;<|<<<<<=8=>==>>!???C?G?K?O?S?W?[?_?c?g?k?o?s??@0m00112k2u2222A3Q3[3a3q333333334 444"4)40474>4E4O4Y4c4m4w45 5555%5,535:5A5H5O5X5f5m5t5{555555555555V6]66666666788888899:;;M;T;Z;d;j;;;??d1133h3345555556+606?6`6f6l6r6y66&7,757D7J7S7y89:M::<<<=A=x==>????`111111111111111112 222222273A3d3333!4(4/464=4D4K4R4Y4`4g4n4u4|445#5G5`5h5o5y5555555536A6\6y66666666666666677@7O7U7~777777778 888*80888=8B8H8M8^8d8s8y888888888888909999C:M:S:]::::;";,;6;O;];;;;;5>&>/>4>:>E>>>>??H0e0x001"1'14191Q1_1c1i1m1s1w1}11111111112)2f4s4~44444444444,515P5U5\5a5555555555555566 666!6(6-686=6D6I6T6Y6`6e6p6u6|666666666666666667%747:7G7S7Z7l7777777777777778880858{888888888899'93989?9D9O9T9[9`9k9p9w9|999999999999999999: :::%:1:6:T:s::::::::::::::::::::;;!;-;<;H;W;c;h;x;;;;;;;;;;;;;< <<)<.<>> >>>#>(>3>8>?>D>O>T>[>`>k>p>w>|>>>>>>>>>>>>>>>>>>>?????$?/?4?;?@?K?P?W?\?g?l?s?x????????????????????(0000 0+00070<0G0L0S0X0c0h0o0t000000000000000000001 1111'1,13181C1H1O1T1_1d1k1p11111111111111111122 222$2)24292@2E2P2U2\2a2l2q2x2}22222222222222223 333-383<3B3G3N3S3c3q3|3333333333333333444444*4/464;4K4Y4d4h4n4s4z444444444444445585=5D5I5Y5g5r5v5|55555555555555556 666%636>6B6H6M6T6Y6d6i6p6u6666666666666666667 7777"7)7.797>7E7J7U7Z7a7f7q7v7}77777777777777777778 8888%8*858:8A8F8Q8V8]8b8m8r8y8~88888888888888888889 999!9&91969=9B9M9R9Y9^9i9n9u9z9999999999999999999:::::":-:2:9:>:I:N:U:Z:e:j:q:v::::::::::::::::::::; ;;;;);.;5;:;E;J;Q;V;a;f;m;r;};;;;;;;;;;;;;;;;;;;; <<<<%<*<1<6 >>&>1>8>?>C>I>N>U>Z>j>>>>>>>>>>>>>>??"?.?=?I?S?X?_?d?o?t?{??????????????????? 000 000#0(03080?0D0O0T0[0`0k0q0w000000000 11!1.161U1a1|11111112 2$2/2F2M2U2b2~2222223 333%3A3J3P3W3]3i3|3333333333344 4:4I4X4444445%5*5>5N5b5s5556K6\6666667-7f7777778899999;;;;;<<====>>5>E>Q>e>}>>??/????????000%0=0T0|00000011(141:1I1Z1m1D3b3r33344445&5<5C5N5T5\5b5k5p5y55556 6.6?6M6[6::::::::;n;;;;.<<<<<<< ==K=Q=o=v=======1>O>>>>>>>>?? ??&???m???@00111R3j33334D4g4s4444444445 5.5E5T5[5j555555566T6r66666<7H7S7~77777D8R8x888 9,9x999 :X:{:::8;J;U;[;g;;;;;;;<<<<<= ===*=1======>)>9>f>>>>>>>>>>>>? ???!?(?-?2??????P 0050r0{0001/1122262@2D2H2L2P2T2X2\2`2d2h222Z33)4}4444B5^556*616m67)7B7Y7y77868899999::B:I:O:V:]:::>>??O?~????`L0A0W00000)1E1R1111112223w333334>4d4;7`7A:f::=_?p\ 1&1G1W1y111111162Y2l223`66777778R8889,99999t::::;8;s<==h@0O0(2,2024282<2@2D2H2L2P2T22 3h3y3E4g44"595J5z5555A7V77778x98:;<>a>>>>> ?I?i?y?? 466 7779:L>g>>>d12Q334456Y6p;$4445Y799:J<4z495o577+88-9<< ==>]>T?000000 1|1o2)355R66788:`;T>d>0@11x233/5x778I88889V9n90:::_:c:g:k:o:s:w:{:::::::::::#;T;a;i;t;;;;;;;<<<<<<<<<<==="=,=6=@=J=U=]=e=o=y=============== >>U>k>>>>>>>?'?3???K?x???????0 0 0'0,090>0X0e0k0v000000000000000001111#1+181?1C1H1T1k1x11111111111111111112 222 2)20242;2D2K2O2V2_2f2j2q2z2222222222222222222233 333#3'3.373>3B3I3R3Y3]3d3m3t3x3333333333333444!4.444?4L4R4]4j4p4{44444444444445555!5%5,555<5@5G5P5W5[5b5k5r5v5}5555555566&66667D7`77778 88)8/8=8C8t8z8;9p99999":>:G:;;<<</>~>>????00 0 001t2222223B3a3m3x333 44F4V4444445>5R555556"6O6c666667 77778t889 999!9:9C99i:y:::::::: ;;;B;O;V;\;;;;;;;;5<<===== >>H>N>w>}>>>>> ?+?1?W?]??0`0f0000161S1_1e1k1q1~1111111d2m2334444445?5^5u556666667787B7P7X7_7|77777778+888x88::;;;;; <()>b>>> ?C?g?n??? l000122 2$2(2,2l2p2t2x2|2222222373w3|3333344F6L666637`7778993::;$;Y<_<>&>0t3v4444G6z88888 9 969=9P9d9999&:C:::::,;7;`;j;~;;;;;;;;0<<<===y>>>>>>>???@d000P0s00,11191Y1b1l1t11111172B2T2Z2l2w22222Q345C66T790;A;X;g;m;< =>)><>PXB13"434T4e45:6d7798A899::;7>>>>>#>'>+>/>3>7>;>?>C>`T]111123.3:3333 43455699A97::;0;7;o<<<<<<>>>?0???L?y?pD%0X00Y2]2a2e2i2m2q2u2g33P4{4H5559G9Z:;;;=<>i>>H??(012:444E6666648{8*= >5?,s0734Y55666888)::<<L0001<1v111242B2]222f33333H5a5g5m6890:7:;;M;j< =?30 1$1(1,10141L1P1T1X1\1122222N5\5j5~55555555555 66+6>6G6j6s666666666677"7H777888888888W9k9@;W;~;;;;;<<<<.=J=r=====>6>a>r???p03"383D3Y3_3j3p3y3333333333333444 4&454;4G4Z4p4x4~444444456668889=h> ??|00=1[1x1+2Q22 3 4464;4K4S4\4g4m4445556f66777R8x88889 919V9x999999::;=@======>!><>f?l0{1/223444i5v5555556677%727X7j7777777788'8<8v888S9n9}99W:::.;8;>; >?@00001111#10191Z1`1f1V2m222222.373D3Q3|33330555555 696L6S6|6666666 777'7l7{77777777(8.878{88888888 9 9?9F99999999 ::8:>:G:`:g::::::: ;;%;.;b;v;|;;;;;;;<< <,>%>,>@>P>V>_>w>>>>>>>??!?d?r?????0I0W00001&1A1[1g1{1111112 2:2A2_2p22222333344*41474?4H4N4U4\4c4j4w44444444444444445 555#5*51585E5[556=666 7'7G7r78999999:::::: ;!;3;B;;<%==>>>>>>>>  0M01.111S22223 33A3P3]3h3s3|3445_5e555}666667 7777777"8(8.889 9979A9b9h9999999:G:M:k:::::&;;;;;;;;;;;;#<2<:m>>>>??:?]????0L000"1?1e1x1~111111112+282M22223,393K3S333333 4#4.4B444444444445 555^5555555M6666666666c77777777778889999:$:):a:h:z::: ;,;9;H;`;;;;;+<< >??0?W?r??@00_0g0v0{00Q1_111111111111222%2:2[2s2|222222$323s3333 4404^4x44 5)5?5f5677>7D7O7U7]7f7n7s7{77777777788J8W8o8v8888 98999 ::':B:[:`:::::::-;G;|;;;<`<<<<G>>???Phr0x0,1b11111)22345r6666677$999::5;V;(<'=X=c=q=x====>>o>>>>> ?&????`(00000A000 111!151<1N1h1111111112 222#2+212A2N2T2b2q2222353\3z33333333O4u4~4444444444552595H5V5555566"6/666Q6}666666667<7778(8.8888888889C9}9999:::#:+:4:::Q:W:^:e:k:::::P;e;;;;3>$>`>y>>m?p(0L0j0|0071222X2l22222233F3^3i333444$4>4K4Y4p444595R5}555556-646F66667 7$7-7E7`7f77777777718;8H8z8888999C:a::::3;q;;#><>I>>>9?B?q?80H0001112/2Z344566I7~7777777,858<8E8g8p8}888899999:2:D:::::;9;;?6>W>m>>>>>t???0b2i2o2t2{222222o33333333&4z4445<5e5555\6g6{66666666667!7*7:7[7u7T8l8}888!9'9q9999999999999<<<<<<<<<>>&> ?h2222223333o366666667 77+88y9M;e;s;z;;;;;;;=?/???????????D0*004O4i4|444444447;;;;;;;<< >>>hc1~11111111133344 4'4.454<4 6(646;6A6G6[6b6i6p6T9l9z99999999:h;<<~=0>>?1+171>1D1J1^1e1l1s1333333444%4?6W6e6l6r6x66666888888999%9;;;;;;;;;;>??? ?&?A?H?O?V?\3&343;3A3G3b3i3p3w33K6f6r6y6666666999: ::-:4:;:B:z:>4>@>G>M>S>g>n>u>|> p11+12181>1Y1`1g1n134!4(4.444H4O4V4]4B8Z8h8o8u8{88888::::::::::==========?0P0#0*00060Q0X0_0f001>2333333 44449:<<5>M>[>b>h>n>>>>>@Ts11111111111125555556(616:6A6G66::):0:6:<:W:^:e:l:?P81K223m4578919899: ;;<<'==5>>\?i?`H000&1@1111G2l22"3@3]3665777q99(;;;i;;;<|<>>?p,0222(6K6666 ;0;=<>]>?&???1113 333333#3'3+3/333?3e333333334!4,474B4M4i4t44444&5Q5q55566777777889:;:^::::::;;%;=;E;;;;;;;.>?p 00-00000001<1K1u1111m22222223$3/3F3[3q355c666677~99S:p:: ;';;<=&=-=V=>t0~1;3H333 4445!5>5\5b555568V8v888979:;@;c;;;@<^<{<@=|====+>9>K>j>s>>>>?#?o?????=0001131@1i1t11111 2#2/2q2{222333344555666X7(8p88889999:;:M:Z:c:::;8;V;c;y;;=7========= >t>>>>>>>???????????@000223E334555556H6*77770:*V>w>>??8000!22345S55666748'????80e00#1G1138::;;;;;;%<<<<=>(>81162f2x222S3j3v3333344494I4478888:::::::X;\;`;d;h;l;p;t;x;|;;;;;;;;;;;;;;;;;;;;;;;;;;;; <+<=>(14(44^6|668<8V8v8F:i::= P%001r1%4H4666677R777777"8?8C9T::';E;b;?<==>>B?c??????000!1G1R1j1t1~11111111221282g222|333333333.4?4T4444/5[5e5n55666666:7V7777d8y88888959U9^9}9999::(;4;t;;;;; <<+->D>M>^>s>>>>>>>?????@00 000001'1111[2g2|2222222333/3^3g333334414R4r4444415<5v566678888909T99=:G:_:::=;[;a;p;;;;;<<<=$==>>>>>>>>.????P00k111112233&3B3Y33334444R555646Q66Q788C9P99!:<:h:::D;X;n;u;;;;<<<<<======\>b>s>>>>$?6?=?Q??`t011:1162[2r2|22222223<3]3}33'4c4456667B77P888 9W9r9:]:z::;:}>>>>>???p0W00000011$1/1Z1_1f1111112 2:2Q2V2x2222223O3`34R444S55 6:6C6V6e666777 808=899999$:.:M:n::::;;;< ==G=Z=m=====>\??x 0%0.0\0u000001X1111 2(2U2[2t2222223<3333424C4V4u444444<557`7!899;:H:$;4;Q;v;^>?0O35[7y779=(6x99<+==W>r>>>>?6????`]0c000T1o1y1111.2q224X4h4444t556-6J6]6666747::p==>r>>>??.?O???<0,0I0s00 1+1H11340445'5G58888q;;h===><0s023D4d4s4446|777q888*9799:::;;===H11111.4U5c666,7789:b:~::::`;s;?>>>??? |>013 3/3N3[3m33333334&434E4d4s4444444 5(5E5b5555556-6J6u6666-7A7778G9::6:e:::l;-=7==0D0062s23457778G8Q8Z8n888886::;!?2?@,12N344678(869q999<=0=P=P4G02`2222R55b688q9B:b:q:::<<=7=`T002R22223N5i5557838S8:/;K;w;;;<&>> ?d??pP/060]0{0011l2q2$357_789(99::::::;v;;<=Y======??T011.1;1\1|122 34)4J4j4%6H6q678/8A8_8v8888 99?9`99M:p:j>>>??H001U2s22J3W3345;>>>>>/?D?V?l?????0g1p1~111112 222=3]3x3414^4535586U6666667 777777888<8Z8w8888V9d994:?::R;_;;<<>>>>>??,?TF0U0a00000111111)2/2 3G45,67778U9u9";Q;;L=v===>V>>>/??D01>2K2a20353'667a99999:N::A;Y;;U0000011111272T2+3K3j333333b4444445j556666678+8Q8j89:0:G:^>?5?U????????@0?00y1 477Z9f9<:;;;;;<<C?Z??\0/0H00 1!1A1111212w22225l6r6|66666666N7 9I9}999w:>-?3?D?f???Hn0u0|0000000000*3I3335N7999999999: ::4:I?D62=2D2K2[2g2n2u2|222Q4 6 8999999999:;;4=?? 800101N1~1124444\5c5j5q55h7'8c;o<5>?0p0B1V1111111111|2224|6678X99:M:x:::::::;-<,=}=================@h23333344444 5*575556'6-6L6V6\666666666)77738c8{8888X999====9?F?P)00{1111&2?2X22222334R4V4Z4^4b4f4j4n4r4v4z4~444444467:89+9D9]9n99::&:O:s:::::::Q;[;u;;;;;;O<>>>>?G?c?????``0i0000?1_1n111E33'4G4V4v44444457778*88 ::::::#:':;< <<<%>>?????p0:0T0e00000001?1q11 22+2X2}222222 3~333B5o55556 7K7a77999:;;;;@k>{>>>>>^????h'0z000 101y112d55666677778848@8M8m8y88k:v::::;;.;.>/???@000G0 1S1b1111232=2W2l2222233\3r3333334!5,5]5m555556 666666y77W8888888889999999999:0:Y:s:}:::::m;|;;;;;;;;;;;;;< <<<$<4<;<@>%>3>H>P>\>j>y>>>>>>>>>>>>>??!?*?3?5U555556T6^6w667K7U77777$808888889,9;9B9L9V9{999:;;K;o;<<<'<-`>n>>-?t000 11)131E1O1a1h11133334;4M4\44448899S:j;<<<<< ==e>i>m>q>u>y>}>>>>>>>>?B??$00:1j11111^366:::t 0.0"1@1]1111 2!2.2Q2223=3Z3333 434{44p55555A66666'7M77778"8T88889'9u99X:z==T?d?(801k2t4589T:::;;;D=o==H,2T2*55556$66P7g79999 ;N;y;;;6>>5?T?? N0z0001/1.2P2q2444,5:5A5J555?6d6666 77;7X7d777 8>8o88889 :::1:E:U:w::::;);3;;;C;W;;;<.<6<><[<] >>'>2>7>D>a>i>>>>>>N?i?? 000 0000 0$0(0004080<0@0H0L0P0T0X0\0`0d0h0l0p0t0x0|00000000000000000000000000000000111 11111 1$1(1,1014181<1@1D1H1L1P1X1\1`1d1h1l1p1t1x1|11111111111111111111111111111111222 22222 2$2(2,2024282<2@2D2H2L2P2T2X2\2`2d2h2l2p2t2x2|222222222222222222222222222222222333 33333 3$3(3,3034383<3@3D3H3L3P3T3X3\3`3d3h3l3p3t3x3|333333333333333333333333333333333777777777777777777777777777888 88888 8$8(8,8084888@8D8H8L8P8T8X8\8`8d8h8l8p8t8x8|888888888888888888899 99999 9$9(9,9094989<9@9D9H9L9P9T9X9\9`9d9h9l9p9t9x9|99999999999999999999999999999999::: ::::: :$:(:,:0:4:8:<:@:D:H:L:P:T:X:\:`:d:h:l:p:t:x:|:::::::::::::::::::::::::::::::::;;; ;;;;; ;$;(;,;0;4;8;<;@;D;H;L;P;T;X;\;`;d;h;l;p;t;x;|;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;<<< <<<<< <$<(<,<0<4<8<<<@>> >>>>> >$>(>,>0>4>8><>@>D>H>L>P>T>X>\>`>d>h>l>p>t>x>|>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>??? ????? ?$?(?,?0?4?8?>> >>>>> >(>,>0>4>8><>@>D>H>L>P>T>X>\>`>d>h>l>p>t>x>|>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>??? ????? ?$?(?,?0?4?8?>> >>>>> >$>(>,>0>4>8><>@>D>H>L>P>T>X>\>`>d>h>l>p>t>x>|>>>>>>>>>>>>>>>>>>>>>>>>>>???? ?(?,?0?4?`?d?h?l?p?t?x?|?????????????????????????????????P h000 00000 0$0(0,0004080<0@0D0H0L0P0T0X0\0`0h0l0p0t0x0|000000000000000000000000000000000111 11111 1$1(1,1014181<1@1D1H1L1P1T1X1\1`1d1h1p1t1x1|111111111111111111111111111111111222 22222 2$2(2,2024282<2@2D2H2L2P2T2X2\2`2d2h2l2p2x2|222222222222222222222222222222222333 33333 3$3(3,3034383<3@3D3H3L3P3T3X3\3`3d3h3l3p3t3x3|333333333333333333333333333333333444 4444 4$4(4,4044484<4@4H4L4P4T4X4\4`4h4l4p4t4x4|444444444444444444444444444444444555 5555 5$5(5,50585<5@5D5H5L5P5T5X5\5`5d5h5l5p5x5|5555555555555555555555555555555666 66666 6$6(6,6064686<6@6D6H6L6P6T6X6\6`6h6l6p6t6x6|66666666666666666666666666666666777 77777 7$7(7,7074787<7@7D7H7L7P7T7X7\7`7d7h7l7p7t7x7|7777777777777777777777777777777888 8888 8$8(8,8084888<8@8D8H8L8P8T8X8\8`8d8h8p8t8x8|8888888888888888888888888888888899 99999 9$9(9,9094989<9@9D9H9L9P9T9X9\9`9d9h9l9p9t9x9|999999999999999999999999999999::: ::::: :$:(:,:0:8:<:@:D:H:P:T:X:\:`:8;<;@;D;H;L;P;T;X;\;`;d;h;l;p;t;x;|;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;<<< <<<<< <$<(<,<0<4<8<<<@>> >>>>> >$>(>,>0>4>8><>@>D>H>L>P>X>\>`>d>h>l>p>t>x>|>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>??? ????? ?$?(?,?0?4?8?>> >>>> >$>(>,>0>4>8><>@>D>H>L>P>T>X>\>`>d>h>l>p>t>x>|>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>??? ????? ?0?4?8?>> >>>> >$>(>0>4>8>@>D>H>P>T>X>`>d>h>p>t>x>>>>>>>>>>>>>>>>>>> h0l0p0t0x0|000000000000000000000000000000000111 11111 1$1(1,1014181<1@1D1H1L1P1T1X1\1`1d1h1l1p1t1x1|111111111111111111111111111111111222 22222 2$2(2,20282<2@2D2H2L2P2T2X2\2`2d2h2l2p2t2x2|2222222222222222222222222333 33333 3$3(3,3034383<3@3D3H3L3P3T3X3\3`3d3h3l3p3t3x3|333333333333333333333333333333333444 44444 4$4(4,4044484<4@4D4H4L4P4T4X4\4`4d4h4l4p4t4x4|444444444444444444444444444444444555 55555 5$5(5,5054585<5@5D5H5L5P5T5X5\5`5d5h5l5p5t5x5|555555555555555555555555555555555666 66666 6$6(6,6064686<6@6D6H6L6P6T6X6\6`6d6h6l6p6t6x6|666666666666666666666666666666666777 77777 7$7(7,7074787<7@7D7H7L7P7T7X7\7`7d7h7l7p7t7x7|77777777777777777777777777777777888 88888 8$8(8,8084888<8@8D8H8L8P8T8X8\8`8d8h8l8p8t8x8|88888888888888888888888888888888999 99999 9$9(9,9094989<9@9D9H9L9P9T9X9\9`9d9h9l9p9t9x999999999999999999999999999999999::: ::::: :$:(:,:0:4:8:<:@:H:L:P:T:X:\:`:d:h:l:p:t:x:|:::::::::::::::::::::::::::::::::;;; ;;`;d;h;l;p;t;x;|;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;<<@>> >>>>> >$>(>,>0>4>8><>@>D>H>L>P>T>X>\>`>d>h>l>p>t>x>|>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>??? ????? ?$?(?,?0?4?8?>> >>>>> >(>,>0>4>8><>@>D>H>L>P>T>X>\>`>d>h>l>p>t>x>|>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>??? ????? ?$?(?,?0?4?8?>> >>>>> >$>(>,>0>4>8><>@>D>H>L>P>T>X>\>`>d>h>l>p>t>x>|>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>??? ????? ?$?(?,?0?4?8?>> >>>>> >$>(>,>0>4>8><>@>D>H>L>P>T>X>\>`>d>h>l>p>t>x>|>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>??? ????? ?$?(?,?0?4?8?>> >>>>> >(>,>0>4>8>@>D>H>L>P>T>X>\>`>d>h>l>p>t>x>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>??? ????? ?$?(?,?0?8?>> >>>>> >$>(>,>0>4>8><>@>D>H>L>P>T>X>\>`>d>h>l>p>t>x>|>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>??? ????? ?$?(?0?4?8?@?D?H? `h00001,1P1d1l1t1|111111111111111112 222$2,242<2D2L2T2\2d2l2t2|222222222222222223 333$3,343<33333333333333444 4d444444<5X5`5555 6(606t666667D7`7h777780888|888899L9h9p9999,:H:P:::::;;\;x;;;;;,H>P>>>>>??\?x????? $0@0H0000011T1p1x1111282@2222233L3h3p3333484@4444455T5p5x555566(686p6t6666666(7,787H7777777770848@8P88888999 999;;;;;;;;;< <<$<0<<$>(>,>0>4>8><>@>D>H>L>P>T>X>\> >d?0 2T5X5\5`5d5h5l5p5t5x5|555555555555555555555555555555555666 66666 6$6(6,6064686<6@6D6H6L6P6T6X6\6`6d6h6l6p6t6x6|666666666666666666666666666666666777 77777 7$7(7,7074787<7@7D7H7L7P7T7X7\7`7d7h7l7p7t7x7|777777777777777777777777777777777888 88888 8$8(8,8084888<8@8D8H8L8P8T8X8\8`8d8h8l8p8t8x8|888888888888888888888@ L;;;;<<(<@ >8>p>>?0?@?X?h????P 0h000181p1111 2P2222203h3333334(4`4444405h555(6x666787P777808`8888(9X9999:H:x:::(;;;0H>x>>>?P?h????` 0`0001@1x111202H22222(3X333304`4444 5P5555(6@6p66666 7P7h77778@8x8888(9X9:::::::;;; ;;;;; ;$;H<<<<<<<<<<<<= ===== =$=(=,=0=4=8=<=@=D=H=L=P=T=X=\=`=d=h=l=p=t=x=|===============p H7L7P7T7X7\77777777$8,848<8D8L8T8\8d8l8t8|8888889999 9$9::::::====================>>>> >(>0>8>@>H>P>X>`>h>p>x>>>>>>>>>>>>>>>>>???? ?(?0?8?@?H?P?X?`?h?p?x????????????????? 40000 0(00080@0H0P0X0`0h0p0x000000000000000001111 1(10181@1H1P1X1`1h1p1x111111111111111112222 2(20282@2H2P2X2`2h2p2x222222222222222223333 3(30383@3H3P3X3`3h3p3x3333333335556 666$6,646<6D6L6T6\6d6l6t6|666666666`9d9mschart.dbg